Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU264
Organism Information
Organism Name
Streptococcus gordonii strain M99
Domain
Bacteria
Classification
Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
gspB
 
 
Protein Information
Protein Name
GspB
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|Q939N5|Q939N5_STRGN Platelet binding protein GspB OS=Streptococcus gordonii
GN=gspB PE=4 SV=1MFFKRQKGQYHEVERVTRFKLIKSGKHWLRAATSQFGLLRLMKGSDVSSTEVKVVEEQS
VEKSGLNYLKGIIATGAVLGGAVVTSSSVYAEEEQAHEKVIDTRDVLATRGEAVLSEEAATTLSSTEANPVESLSD
TLSASESTSASSSVSTSISVSESFSVSGSLSYSTSLSQSVSASASASESLSVSSSASDSVSASTSTSASASQSVSA
SQKSTISTSESTRSESSQQSTEASSQTGRRRTRRAVTESAPNVEYHDVKGDMIQSVTTSFDDTSRLLTWTINLTPR
QVKSNLGALVSISGNQETRTVTINGKNAANGGVYNSGGAWNLYTGESVNNNVLRITTQVNDTGGEVKLGLRLVTSD
KKITKTNLPLEFSQVAATTNGSWDKAGYNTTIVEKDTERPVVNVPSEITVYRGESFEYFATVTDNSNAFDLAKTVV
RWLYNNQPGRGTEWLQYSVTQVGNQLKVRIFGNVPIDTTIGDYTRYVVATDAAGNVNATQTEMGNAAVDKTSVNGQ
FKLIIRFRIKTPENTVFVNNPNQLTEVEKNLVREAVKKSNPDLRAQDVLNSNYVTGITVSNNGTTTITYRDGRKDI
IDGSKFIDTRAGSISKSQSTSNSISVSLSKSESASASLVTSKLNSISSSASVSASTSISTSGSVSASESASTSSSV
SASESASTSASVSASESASTSASVSASTSASTSASVSASTSASTSASTSASKSASTSASVSASTSASTSASVSASE
SASTSASVSASTSASTSASVSASTSASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASTSAST
SASVSASASASTSASVSASTSASTSASVSASASASTSASVSASTSASTSASVSASESASTSASVSASESASTSASV
SASESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE
SASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASESASTSASVSASESAST
SASVSASTSASTSASVSASESASTSASVSASESASTSASESASESASTSASVSASESASTSASVSASESSSTSASV
SASESSSTSASVSASESASTSASVSASESASTSASESASESASTSASVSASESASTSASVSASESASTSASVSASE
SVSTSASVSASESASTSASVSASESASTSASESASESASTSASVSASESASTSASVSASESASTSASVSASTSAST
SASVSASESASTSASVSASESASTSASVSASESASTSASVSASESVSTSASVSASESASTSASVSASESASTSASE
SASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASE
SASTSASVSASTSASTSASVSASESASTSTSVSTSTSASTSASVSASESASTSASVSASESASTSASVSASTSAST
SASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASV
SASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE
SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESAST
SASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASV
SASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSTSTSASVSASE
SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESAST
SASVSASESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSASV
SASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASKSASTSESASTSA
SVSASESASTSASVSASESASTSASVSASESVSTSASVSASDSASISASVLASESASTSASVSASESASTSASVSA
SESASTSASVSASESASTSSSVSASESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESA
STSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSA
SVSASESASTSASVSSSESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA
STSASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASESA
STSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSA
SVSASESASTSASVSASESASTSASVSASESASTSASVSASMSASTSASVSVSESTSTSASVSANESASTSASVSA
SESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESA
STSASVSASESASTSASVSASESASTSASVSASTSASTSASVSANESASTSASVSASESASTSASVSASESASTSA
SVSASESASTSASVSASESASTSASVSASTSASTSASVSANESASTSASVSASESASTSASVSASESASTSASVSA
SESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASASASESASTSASVSASESASTSASVSASESA
STSASVSASESASTNASVSVSESMSVSESLSLSISTSVLHSQLNDIYESELYSLSLSESLSASQSLSQSLSESQSS
SASQSMHDRISKGQLPRTGESENKASILALGLGALGLAFKKRKKNESED
Sequence length
3072 AA
Subcellular Location
Secreted (surface anchored)
Function
286-kDa GspB is a platelet binding protein.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
ConA binding, DIG (digoxigenin) Glycan detection.
 
 
Glycan Information
Glycan Annotation
Approx. 10% (wt/wt) total carbohydrate is present in GspB105 and approx. 9% (wt/wt) carbohydrate in GspB194. Carbohydrates contain N-acetylglucosamine and some amounts of glucose or mannose.
 
 
Literature
Reference(s)
1) Bensing, B.A., Gibson, B.W. and Sullam, P.M. (2004) The Streptococcus gordonii platelet binding protein GspB undergoes glycosylation independently of export. J Bacteriol, 186, 638-645. [PubMed: 14729688]
2) Takamatsu, D., Bensing, B.A. and Sullam, P.M. (2004) Four proteins encoded in the gspB-secY2A2 operon of Streptococcus gordonii mediate the intracellular glycosylation of the platelet-binding protein GspB. J Bacteriol, 186, 7100-7111. [PubMed: 15489421]
Additional Comments
Truncated derivatives of GspB- GspB105, GspB274 and GspB194 are also glycosylated. These are freely secreted. Gtf and Orf4 (glycosyltransferases) mediate intracellular glycosylation of GspB. Gly and Nss also contribute to this process. These are encoded in the gspB-sec operon. Mutation of one of them abolishes GspB expression. Two serine-rich repeats (SRR1 and SRR2) are glycosylated. Glycosylation is essential for the GspB solubility.
Year of Identification
2004
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.