Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU265
Organism Information
Organism Name
Streptococcus parasanguis FW213
Domain
Bacteria
Classification
Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
fap1
 
 
Protein Information
Protein Name
Fap1 (Fimbrial adhesin)
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|Q9ZFF9|Q9ZFF9_STRPA Fimbriae-associated protein Fap1 OS=Streptococcus parasa
nguis GN=fap1 PE=1 SV=1 MHKSGKNWVRTLISQIGLMHFLGGSISEKKINVDVYEQKNISASTILKGAVA
LGALTGAT VVSGNVFADETVLAKETTLTTTDANEVKLSSENFDSEKAEEKISLSQSESASESVSESIS ESVSES
VSTSESVSESVSESVSESISESVSESISESISESVSESTSTSIVLSESGAASGN KATSKGTEEKQDSVRENLDKM
ISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEA TKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKL
NPNGQIYAVLNNTEASRAATLRST TTGTKTTFTISDFSNGGTQYYWAGGNANNLKNPISSISAVYDSATGKISWT
VEYDPTTIL KSPALKTLKTYTGIYIDTSSDSKLSTPTNVLIDGAATNPVTNFYGNGSKGIEYVSKGTTK GVTKH
TITFDTAFSGRANDLADLEIKMLAATTLSDPHFYEDGSKGNYGRYNGQTAPYVIA NDSGTAIGGYQVSGVNADSI
PSDTTSQSESASKSESTSKSISESVIESISESVIGSVSES VSESVSESVSESITESVSESVSESISESVSESVSE
SISESVSESVSESISESVSESVSES ISESVSESVSESISESISESVSESVSESISESVSESVSESISESVSESVS
ESISESVSES VSESISESVSESVSESISESVSESVSESIXESVSESVSESISESVSESVSESISESVSES VSES
ISESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESISESVSES VSESVSESVSESVSESVSE
SISESVSESVSESISESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESISESVSESVSESIS
ESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESVSESVSESVSESVSESVSESISESVSESV
SESISESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESVSESVSES ISE
SVSESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSES VSESISESVSESVSESIS
ESVSESVSESISESVSESVSESISESVSESPSESISESVSES VSESISESVSESVSESVSESVSESVSESISESV
SESVSESISESVSESVSESVSESISES VSESVSESSSESVSESVSESISESVSESVSESISESVSESVSESVSES
VSESVSESVSES VSESVSESVSESISESVSESVSESVSESISESVSESVSESISESVSESVSESISESVSES VS
ESISESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESISESVSES VSESISESVSESVSESI
SESVSESVSESISESVSESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESVSESVSESVSES
VSESVSESVSESISESVSESVSESISES VSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISE
SVSESVSESISES VSESVSESVSESVSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESVSES V
SESVSESISESVSESVSESVSESVSESVSESISESVSESVSESISESVSESVSESISES VSESVSESISESVSES
VSESISESVSESVSESISESVSESVSESISESVSESVSESVSES VSESVSESVSESVSESISESVSESVSESISE
SVSESVSESISESVSESVSESVSESVSES VSESISESVSESMSESISESVSESVSESISESVSESVSESISEPVS
ESVSESVSESISES VSESVSETISESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISES
VSESVSESVSESVSESVSESISESVSESISESVSESVSESISESVSESVSESISESVSES VSESISESVSESVSE
SISESVSESVSESISESVSESVSESISESVSESVSESISESVSES VSESVSESISESVSESVSESISESVSESVS
ESISESVSESVSESVSESVSESVSESVSES VSESVSESISESVSESVSESISESVSESVSESISESVSESVSESI
SESVSESVSESISES VSESVSESISESVSESVSESISESVSESVSESVSESVSESVSESISESVSESVSESVSES
ISESVSESVSESISESVSESVSESVSESVSESVSESVSESVSESVSESISESVSESVSES VSESVSESVSESIS
ESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSES ISESVSESVSESISESVSESVSESISESV
SESVSESISESVSESVSESVSESISESVSES VSESISESVSESVSESISESVSESVSESISESVSESVSESVSES
VSESVSESVSESVSES ISESVSESVSESISESVSESVSESVSESVSESVSESISESVSESISESVSESVSESISE
S VSESVSESISERTLPNTGENVSSSLGLVGLSGLLFGALLGRKKRKSEDAE
Sequence length
2570 AA
Subcellular Location
Secreted
Function
The Fap1 adhesin protein (identified as the major fimbrial subunit) is essential for fimbrial biogenesis.
 
 
Protein Structure
PDB ID
2KUB, 2X12
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Periodic acid-Schiff (PAS) staining
 
 
Glycan Information
Glycan Annotation
Monosaccharide composition detected by gas-liquid chromatography revealed the presence of several different isomers of glucose, galactose, N-acetylglucosamine, N-acetylgalactosamine, and rhamnose at a ratio of 29:5:39:1:1.
 
 
Literature
Reference(s)
1) Stephenson, A.E., Wu, H., Novak, J., Tomana, M., Mintz, K. and Fives-Taylor, P. (2002) The Fap1 fimbrial adhesin is a glycoprotein: antibodies specific for the glycan moiety block the adhesion of Streptococcus parasanguis in an in vitro tooth model. Mol Microbiol, 43, 147-157. [PubMed: 11849543]
Year of Identification
2002
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.