Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU269
Organism Information
Organism Name
Streptococcus sanguis SK36
Domain
Bacteria
Classification
Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
srpA (SSA_0829)
NCBI Gene ID
 
 
Protein Information
Protein Name
SrpA
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>tr|A3CM52|A3CM52_STRSV Platelet-binding glycoprotein OS=Streptococcus sanguinis
(strain SK36) GN=srpA PE=4 SV=1 MFFKRQKGKYHEVERVTRFKLIKSGKHWLRAATSQFGLFRSMK
GGGLSSIELKVTEEQVT DKKSGIDFLRGIVATGAVLGGAVVTSTTVHAEEGQALEKVIDTTDVLATRGETVLGEE
SS AAEAATATASSHTESESVSDTSSASASASVSASISASISASESMSQFSSASISASTSQAV SDSLSVSESLSV
SSSTSDSVSASQPASTSASSKSESTVNSQSASSETNRSSTNNGSTSSS SETARVRKRRATDTTPPTITVPSDIIA
YRGEEFEFYFEITDDSGQVKNIELSTFGKPLGL NWLEYSEDNFNVPGNATSDNPLRVRVHGTVPLNEPIPADKNR
AQFTRTIRAWDAAGNVSS NITFVIKYRAQTDKYNPADPTITYVDRLSSLSPSEKNAVEAAVRAANPQIPAAARIT
VSA NGTVTITYPDSSTDTITANRVVKDLASSRSALTSASTSASTSASVSASTSASLSASTSAS QSIVDSKSASV
SASTSASTSASTSASVSASTSASTSASVSASTSASASASVSASTSASTS ASVSASTSASTSASVSASTSASTSAS
VSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSA
STSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTS
ASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSAS
TSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSA
SVSASTSASTSASVSASASASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVS
ASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSAST
SASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASTSA
STSASVSASTSASTSASVSASTSASTSASVSASTSASTSSSAKASESASTS ASVSASTSASTSASVSASTSASTS
ASVSASASASTSASVSASTSASTSASVSASTSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASV
SASESASTSASVSASTSASTS ASVSASESASTSSSAKASESASTSASVSASTSASTSASVSASTSASTSASVSAS
TSASTS ASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSASTSASTS ASVSASES
ASTSSSAKASESASTSASVSASESASTSASVSVSESASTSASVSTSTSASTS ASVSASESASTSASASASESTSV
RASALALASISASVSASESASTSASLSGSESASISDS QSISESTSVSISTSVLHSQLDLVHEKEFYSLSLSTSES
LSAAVSLSELARVSQSVSESLS TSLSASQSTSESLSASARQSELDLISRGRLPQTGETESKASILALGLGALGLA
FKRRKKK SDSEE
Sequence length
1625 AA
Function
Platelet-binding glycoprotein.
 
 
Glycosylation Status
Glycosylation Type
N(Asn)- linked
Technique(s) used for Glycosylation Detection
Lectin WGA (wheat germ agglutinin) binding.
 
 
Glycan Information
Glycan Annotation
Linkage: GlcNAc-Asn.
 
 
Literature
Reference(s)
1) Plummer, C., Wu, H., Kerrigan, S.W., Meade, G., Cox, D. and Ian Douglas, C.W. (2005) A serine-rich glycoprotein of Streptococcus sanguis mediates adhesion to platelets via GPIb. Br J Haematol, 129, 101-109. [PubMed: 15801962]
Year of Identification
2005
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.