Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU278
Organism Information
Organism Name
Thermoanaerobacter thermohydrosulfuricus (Clostridium thermohydrosulfuricum) DSM 567
Domain
Bacteria
Classification
Family: Thermoanaerobacteraceae
Order: Thermoanaerobacterales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
apu
 
 
Protein Information
Protein Name
α-Glucosidase (thermostable) 160 kDa. Also called amylopullulanase.
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricu
s GN=apu PE=1 SV=1MFKRRALGFLLAFLLVFTAVFGSMPMEFAKAETDTAPAIANVVGNFQSKLGDSDWNIN
SDKTIMTYKGNGFYEFTTPVALPAGDYEYKVALNHSWEGGGVPSQGNLSFHLDSDSVVTFYYNYNTSSITDSTKYT
PIPEDKLPRLVGTIQPAIGAGDDWKPETSTAIMRDYKFNNVYEYTANVPKGNYEFKVTLGPSWDINYGLNGEQNGP
NIPLNVAYDTKITFYYDSVSHNIWTDYNPPLTGPDNNIYYDDLRHDTHDPFFRSPFGAIKTGDTVTLRIQAKNHDI
ESAKISYWDDIKKTRIEVPMYRIGQSPDGKYEYWEVKLSFDHPTRIWYYFILKDGTKTAYYGDNDEQLGGVGKATD
TENKDFELTVYDKNLDTPDWMKGSVMYQIFPDRFFNGDSSNDHLKKYSRGFDPVEYHSNWYELPDNPNDKNKLGYT
GDGIWSNDFFGGDLKGIDDKLDYLKSLGISVIYLNPIFQSPSNHRYDTTDYTKIDELLGDLSTFKKLMEDAHAKGI
KVILDGVFNHTSDDSIYFDRYGKYLNTGVLGAYQAWKQGDQSKSPYGDWYEIKPDGTYEGWWGFDSLPVIRQINGS
EYNVKSWADFIINNPNAISKYWLNPDGDKNVGADGWRLDVANEVAHDFWVHFRGAINTVKPNAPMVAENWNDASLD
LLGDSFNSVMNYLFRNAVIDFILDKSFDDGNVVHNPIDAAKLDQRLMSIYERYPLPVFYSTMNLLGSHDTMRILTV
FGYNSADENQNSQAAKDLAVKRLKLAAILQMGYPGMPSIYYGDEAGQSGGKDPDNRRTFPWGREDTDLQTFFKKVV
NIRNENQVLKTGDLETLYANGDVYAFGRRIINGKDTFGKSYPDSVAIVVINKGDAKQVSIDTTKFIRDGVAFTDAL
SGKTYTVQDGKIVVEVGSMDGAILISDTGQNLTAPQPITDLKAVSGNGKVDLSWSVVDKAVSYNIYRSTVKGGLYE
KIASNVTQITYTDTEVTNGLKYVYAVTAVDNDGNESALSNEVEAYPAFPIGWAGNMNQVNTHVIGVNNPVEVYAEV
WAQGLTDKPGQGENMIAQLGYRYIGDTVGDAVYNAVYNKVEGVEISKDWTWVDAQYVGDSGNNDKYMAKFVPDMVG
TWEYIMRFSSNQGHDWTYTKGPDGKTDEAKQFTVVPSNDVETPTAPVLQQPGIESSRVTLNWSPSADDVAIFGYEI
YKSSSETGPFIKIATVSDSVYNYVDTDVVNGNVYYYKVVAVDTSYNRTASNTVKATPDIIPIKVTFNVTIPDYTPD
DGVNIAGNFPDAFWNPNANQMTKAGSNTYSITLTLNEGTQIEYKYARGSWDKVEKGEYGNEIDNRKITVVNQGSNT
MVVNDTVQRWRDVPIYIYSPKDKTIVDANTSEIEIKGNTYKGAKVTINDESFVQQENGVFTKVVPLEYGVNTIKIH
VEPSGDKNNELTKDITITVTREKPARRQNLLLLHQQKQQNHLKKYHKAK
Sequence length
1475 AA
Function
Exhibits maltase, glucohydrolase (release of glucose from starch and pullulan) and `maltodextrinohydrolase' activity.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Glycoprotein detection kit (GlykoTrack Kit)
 
 
Literature
Reference(s)
1) Wimmer, B., Lottspeich, F., Ritter, J. and Bronnenmeier, K. (1997) A novel type of thermostable alpha-D-glucosidase from Thermoanaerobacter thermohydrosulfuricus exhibiting maltodextrinohydrolase activity. Biochem J, 328 ( Pt 2), 581-586. [PubMed: 9371718]
Year of Identification
1997
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.