Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU279
Organism Information
Organism Name
Thermoanaerobacter thermohydrosulfuricus (Clostridium thermohydrosulfuricum) L111-69 and L110-69
Domain
Bacteria
Classification
Family: Thermoanaerobacteraceae
Order: Thermoanaerobacterales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
sttA
 
 
Protein Information
Protein Name
S-layer glycoprotein
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|C0L3L9|C0L3L9_THETY S-layer protein OS=Thermoanaerobacter thermohydrosulfuri
cus GN=sttA PE=4 SV=1MLKRKLLAFVIVVAMLMSIMAPGFAFNYVTAPGTTPSSSNTVFSPGTTTQSDYTI
VFEKNTAKVGDMVSLVIKVLDKEGKVVTDKKVLETIYKSGLTLNADPRTLVFDTNRSGWIDTNDGSLISATVNDAV
YQTAYPVNNITTTDIRILPSSDVTGFVVASPGTVQFGFISAGQMSFYVANYGRVWVTGSPSIIIDGQSKSVNYDDA
RLYLSGAAPNVSYLSGNTNPLETYPETVLITVPGANYNSAAKAVLTKDDKVLAIIDLVNSAKNINNAKDINNDGIV
DGYKVVLPPMSAGHKYVLTVYNEVNYSNWEFGYGRNYYSVGAVNITPQAAKFELVAPADKVLAAGISDPVTFTLND
KLPNGNTSADNKNLAVDFAKFVRFTVLKSDNKTKDTEVKYVDANEKIANGSWYLVTDDGLKAVSLDTNNNIVLGDP
VANSYEKDSGKITVKAKIPNGDYLKIEAAYTDYVGNLYEVKKLQDFEETFVVANLEAKPGTLTMEPSTINANEYRN
VKFTVKDVHGNPVSGAEIKFSSPIVYLGGTGSTAVGNVGTAVKTGDDGTVTATLFSAFPTSIAVSVSVPVEKTLTL
TINPSQQTGATVVFTIGSDKYTVNGVEKTMDAAPYVKDGRTLVPARYIADAINARSYYDQDTKVVTFVKGDTIVKF
TLGSNKMQVIKNGVVVATQTMETKATTVDASGKDVGRTFILARYLAEAFGYKVDYAKDASGVETVTIY
Sequence length
731 AA
Subcellular Location
Surface
Function
Structural component of the surface layer.
 
 
Glycosylation Status
Glycosylation Type
O(Tyr)- linked
Technique(s) used for Glycosylation Detection
Chemical deglycosylation with TFMS
 
 
Glycan Information
Glycan Annotation
Linkage: β-Gal-Tyr. Terminal (capping) 3-O-methyl-rhamnose. The glycan chain 3-OMeLRhapα1-[4DManpα1-3LRhapα1]n~27-4DManpα1-3LRhapα1-3LRhapα1-3LRhapα1-3DGalpβ1-O-Tyr, is present.
BCSDB ID
 
 
Literature
Reference(s)
1) Bock, K., Schuster-Kolbe, J., Altman, E., Allmaier, G., Stahl, B., Christian, R., Sleytr, U.B. and Messner, P. (1994) Primary structure of the O-glycosidically linked glycan chain of the crystalline surface layer glycoprotein of Thermoanaerobacter thermohydrosulfuricus L111-69. Galactosyl tyrosine as a novel linkage unit. J Biol Chem, 269, 7137-7144. [PubMed: 8125923]
Year of Identification
1994
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.