ProGP183 (GlnH)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP183 (GlnH) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Mycobacterium tuberculosis |
Domain | Bacteria |
Classification | Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" |
Taxonomic ID (NCBI) | 1773 |
Genome Information | |
GenBank | BX842573.1 |
EMBL | BX842573 |
Organism Additional Information | It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens. |
Gene Information | |
Gene Name | glnH (Rv0411c) |
NCBI Gene ID | 886393 |
GenBank Gene Sequence | NC_000962 |
Protein Information | |
Protein Name | GlnH |
UniProtKB/SwissProt ID | P96257 |
NCBI RefSeq | NP_214925.1 |
EMBL-CDS | CAB06581.1 |
UniProtKB Sequence | >tr|P96257|P96257_MYCTU Amino acid ABC transporter, amino acid-binding protein OS=Mycobacterium tuberculosis GN=glnH PE=4 SV=1 MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTPVGMEIMPPQPPLPPD SSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNLFSFRDPITGEITGFDV DIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFSTVYL DANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAPPPVIVSVVNWADCLVALQ QREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGINLDNTGLVRFVNGTLERIRN DGTWNTLYRKWLTVLGPAPAPPTPRYVD |
Sequence length | 328 AA |
Function | Glutamine-binding lipoprotein. |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | Concanavalin A (ConA) binding |
Literature | |
Year of Identification | 2000 |
Year of Identification Month Wise | 2000.02 |
Reference | González-Zamorano, M., Mendoza-Hernández, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C., 2009. Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. Journal of proteome research, 8(2), pp.721-733. |
Corresponding Author | Clara Espitia |
Contact | Departamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico. |
Reference | Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D., 2000. Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. Febs Letters, 473(3), pp.358-362. |
Corresponding Author | Jean Louis Herrmann |
Contact | Department of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Mary's Campus, Norfolk Place, W2 1PG, London, UK |
Reference | Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] |
Author | Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C |
Research Group | Department of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico. |
Corresponding Author | Espitia, C |
Contact | Department of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico. |
Reference | Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240] |
Author | Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. Young, D. |
Research Group | Department of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London, UK |
Corresponding Author | Young, D. |
Contact | Department of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London, UK |