ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Mycobacterium smegmatis |
Domain | Bacteria |
Classification | Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" |
Taxonomic ID (NCBI) | 1772 |
Genome Information | |
GenBank | DQ066883.1 |
EMBL | DQ066883 |
Gene Information | |
Gene Name | hlp |
NCBI Gene ID | 4534852 |
GenBank Gene Sequence | NC_008596.1 |
Protein Information | |
Protein Name | Laminin-binding glycoprotein (MS-LBP) or histone-like protein |
UniProtKB/SwissProt ID | Q4PLR8 |
NCBI RefSeq | YP_886729.1 |
EMBL-CDS | AAY68087.1 |
UniProtKB Sequence | >tr|Q4PLR8|Q4PLR8_MYCSM Histone-like protein OS=Mycobacterium smegmatis GN=hlp PE=3 SV=1 MNKAELIDVLTTKMGTDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA RNPRTGETVKVKPTSVPAFRPGAQFKAVISGAQKLPADGPAVKRGVTAGPAKKAAKKAPA KKAAAKKTATKAAAKKAPAKKAATKAPAKKAATKAPAKKAATKAPAKKAATKAPAKKAAA KAPAKKAATKAPAKKAAAKKAPAKKGRR |
Sequence length | 208 AA |
Function | It is involved in laminin-mediated mycobacterial adherence to human pneumocytes and macrophages. |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | MALDI-TOF MS (matrix assisted laser desorption/ionization time of flight mass spectrometry) analysis and gas chromatography-mass spectrometry(GC-MS) |
Literature | |
Year of Identification | 2001 |
Year of Identification Month Wise | 2001.1 |
Reference | Pethe, K., Puech, V., Daffé, M., Josenhans, C., Drobecq, H., Locht, C. and Menozzi, F.D., 2001. Mycobacterium smegmatis laminin‐binding glycoprotein shares epitopes with Mycobacterium tuberculosis heparin‐binding haemagglutinin. Molecular microbiology, 39(1), pp.89-99. |
Corresponding Author | Franco D. Menozzi |
Contact | INSERM U447, Molecular Mechanisms of Microbial Pathogenesis, Institut Pasteur de Lille, 1 Rue A. Calmette, 59019 Lille Cedex, France. |
Reference | Pethe, K., Puech, V., Daffe, M., Josenhans, C., Drobecq, H., Locht, C. and Menozzi, F.D. (2001) Mycobacterium smegmatis laminin-binding glycoprotein shares epitopes with Mycobacterium tuberculosis heparin-binding haemagglutinin. Mol Microbiol, 39, 89-99. [PubMed: 11123691] |
Author | Pethe, K., Puech, V., Daffe, M., Josenhans, C., Drobecq, H., Locht, C. Menozzi, F.D. |
Research Group | INSERM U447, Molecular Mechanisms of Microbial Pathogenesis, Pasteur Institute of Lille, 1 Rue A. Calmette, 59019 Lille Cedex, France. |
Corresponding Author | Menozzi, F.D. |
Contact | INSERM U447, Molecular Mechanisms of Microbial Pathogenesis, Pasteur Institute of Lille, 1 Rue A. Calmette, 59019 Lille Cedex, France. |