ProGP26 (CenA (Endoglucanase A))
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP26 (CenA (Endoglucanase A)) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Cellulomonas fimi ATCC 484 |
Domain | Bacteria |
Classification | Family: Cellulomonadaceae Suborder: Micrococcineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" |
Taxonomic ID (NCBI) | 1708 |
Genome Information | |
GenBank | M15823 |
EMBL | M15823 |
Gene Information | |
Gene Name | cenA |
Protein Information | |
Protein Name | CenA (Endoglucanase A) |
UniProtKB/SwissProt ID | P07984 |
EMBL-CDS | AAA23084.1 |
UniProtKB Sequence | >sp|P07984|GUNA_CELFI Endoglucanase A OS=Cellulomonas fimi GN=cenA PE=1 SV=1 MSTRRTAAALLAAAAVAVGGLTALTTTAAQAAPGCRVDYAVTNQWPGGFGANVTITNLGD PVSSWKLDWTYTAGQRIQQLWNGTASTNGGQVSVTSLPWNGSIPTGGTASFGFNGSWAGS NPTPASFSLNGTTCTGTVPTTSPTPTPTPTTPTPTPTPTPTPTPTVTPQPTSGFYVDPTT QGYRAWQAASGTDKALLEKIALTPQAYWVGNWADASHAQAEVADYTGRAVAAGKTPMLVV YAIPGRDCGSHSGGGVSESEYARWVDTVAQGIKGNPIVILEPDALAQLGDCSGQGDRVGF LKYAAKSLTLKGARVYIDAGHAKWLSVDTPVNRLNQVGFEYAVGFALNTSNYQTTADSKA YGQQISQRLGGKKFVIDTSRNGNGSNGEWCNPRGRALGERPVAVNDGSGLDALLWVKLPG ESDGACNGGPAAGQWWQEIALEMARNARW |
Sequence length | 449 AA |
Function | Endo-β-1,4-glucanase A. EC=3.2.1.4. Involved in cellulose hydrolysis. |
Glycosylation Status | |
Glycosylation Type | O- (Thr) linked |
Technique(s) used for Glycosylation Detection | PAS-staining and ConA binding |
Glycan Information | |
Glycan Annotation | Linkage: Man-O-Thr, Gal-O-Thr. |
Literature | |
Year of Identification | 1984 |
Year of Identification Month Wise | 1984.8 |
Reference | Ong, E., Kilburn, D.G., Miller Jr, R.C. and Warren, R.A., 1994. Streptomyces lividans glycosylates the linker region of a beta-1, 4-glycanase from Cellulomonas fimi. Journal of bacteriology, 176(4), pp.999-1008. |
Corresponding Author | Doug G Kilburn |
Contact | University Blvd Department of Microbiology and Immunology, University of British Columbia, Vancouver, B.C.V6T1Z3, Canada. |
Reference | Gilkes, N.R., Langsford, M.L., Kilburn, D.G., Miller Jr, R.C. and Warren, R.A., 1984. Mode of action and substrate specificities of cellulases from cloned bacterial genes. Journal of Biological Chemistry, 259(16), pp.10455-10459. |
Corresponding Author | R. Antony J. Warren |
Contact | Department of Microbiolgy, University of British Columbia, Vancouver, British Columbia, Cada V6T 1 W5 |
Reference | Ong, E., Kilburn, D.G., Miller, R.C., Jr. and Warren, R.A. (1994) Streptomyces lividans glycosylates the linker region of a beta-1,4-glycanase from Cellulomonas fimi. J Bacteriol, 176, 999-1008. [PubMed: 8106343] |
Author | Ong, E., Kilburn, D.G., Miller, R.C., Jr. Warren, R.A. |
Research Group | Department of Microbiology and Immunology, University of British Columbia, Vancouver, Canada. |
Corresponding Author | Warren, R.A. |
Contact | Department of Microbiology and Immunology, University of British Columbia, Vancouver, Canada. |
Reference | Gilkes, N.R., Langsford, M.L., Kilburn, D.G., Miller, R.C., Jr. and Warren, R.A. (1984) Mode of action and substrate specificities of cellulases from cloned bacterial genes. J Biol Chem, 259, 10455-10459. [PubMed: 6432782] |
Author | Gilkes, N.R., Langsford, M.L., Kilburn, D.G., Miller, R.C., Jr. Warren, R.A. |
Research Group | Department of Microbwbgy, University of British Columbia, Vancouver, British Columbia, Cada |
Corresponding Author | Warren, R.A. |
Contact | Department of Microbwbgy, University of British Columbia, Vancouver, British Columbia, Cada |