ProGP343 (PilA (FTH_0384))
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP343 (PilA (FTH_0384)) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Francisella tularensis ssp. holarctica strain FSC200 |
Domain | Bacteria |
Classification | Family: Francisellaceae Order:Thiotrichales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 351581 |
Genome Information | |
GenBank | CP003862.1 |
EMBL | CP003862.1 |
Gene Information | |
Gene Name | PilA (FTH_0384) |
GenBank Gene Sequence | NC_008369.1 |
Protein Information | |
Protein Name | PilA (FTH_0384) |
UniProtKB/SwissProt ID | A0SP58 |
NCBI RefSeq | WP_011648587.1 |
EMBL-CDS | AAX14621.1 |
UniProtKB Sequence | >tr|A0SP58|A0SP58_FRATU PilE1 OS=Francisella tularensis subsp. holarctica GN=pilA PE=3 SV=1 MKKKMQKGFSLVELMVVIAIIAILAAVAIPMYSNYTTRAQLGSDLSALGGAKAIVAEKIA NNNGDASQVTILQANAAANGLPSGASVAAGTISYPSTVSGATIQLAPTVSSGAITWTCNI SGVSASQVPSNCNAI |
Sequence length | 135 AA |
Subcellular Location | Membrane |
Function | Type IV pili fiber building block protein |
Protein Structure | |
Protein Additional Information | This protein shares 52.5% similarity with pilE1-encoded pilin (FMM1_NEIGO) of N. gonorrheae, which is modified with Gal 1-3GlcNAc at Ser70. |
Glycosylation Status | |
Glycosylation Type | O- (Ser/Thr) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | One of either S103 or S102 |
Glycosite(s) Annotated Protein Sequence | >tr|A0SP58|A0SP58_FRATU PilE1 OS=Francisella tularensis subsp. holarctica GN=pilA PE=3 SV=1 MKKKMQKGFSLVELMVVIAIIAILAAVAIPMYSNYTTRAQLGSDLSALGGAKAIVAEKIA NNNGDASQVTILQANAAANGLPSGASVAAGTISYPSTVSGATIQLAPTVS*(102)S*(103)GAITWTCNI SGVSASQVPSNCNAI |
Sequence Around Glycosites (21 AA) | GATIQLAPTVSSGAITWTCNI ATIQLAPTVSSGAITWTCNIS |
Technique(s) used for Glycosylation Detection | Hydrazide labeling and lectin affinity chromatography. |
Technique(s) used for Glycosylated Residue(s) Detection | MSMS (Ion trap with electron transfer dissociation (ETD)) |
Protein Glycosylation- Implication | Pilin glycosylation has been shown to play a role in host-cell adhesion and virulence. |
Glycan Information | |
Glycan Annotation | Pentasaccharide (HexNAc-Hex-Hex-HexNAc-HexNAc) is linked through its terminal HexNAc residue to a 162.111-Da moiety via a phosphate bridge. |
Technique(s) used for Glycan Identification | MS (ion trap with tandemMS CID and ETD) |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | PglA |
OST ProGT ID | ProGT50 (PglA) |
Literature | |
Reference | Balonova, L., Hernychova, L., Mann, B.F., Link, M., Bilkova, Z., Novotny, M.V. and Stulik, J., 2010. Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. Journal of proteome research, 9(4), pp.1995-2005. |
Corresponding Author | Lenka Hernychova |
Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
Reference | Egge-Jacobsen, W., Salomonsson, E.N., Aas, F.E., Forslund, A.L., Winther-Larsen, H.C., Maier, J., Macellaro, A., Kuoppa, K., Oyston, P.C., Titball, R.W. and Thomas, R.M., 2011. O-linked glycosylation of the PilA pilin protein of Francisella tularensis: identification of the endogenous protein-targeting oligosaccharyltransferase and characterization of the native oligosaccharide. Journal of bacteriology, 193(19), pp.5487-5497. |
Corresponding Author | Wolfgang Egge-Jacobsen Michael Koomey |
Contact | a.Department of Molecular Biosciences and b.Center for Molecular Biology and Neuroscience, University of Oslo, Oslo 0316, Norway |
Reference | Balonova, L., Mann, B.F., Cerveny, L., Alley, W.R., Chovancova, E., Forslund, A.L., Salomonsson, E.N., Forsberg, Å., Damborsky, J., Novotny, M.V. and Hernychova, L., 2012. Characterization of protein glycosylation in Francisella tularensis subsp. holarctica: identification of a novel glycosylated lipoprotein required for virulence. Molecular & Cellular Proteomics, 11(7), pp.M111-015016. |
Corresponding Author | Lenka Hernychova |
Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
Reference | Balonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567] |
Author | Balonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. |
Research Group | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
Corresponding Author | Stulik J. |
Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
Reference | Egge-Jacobsen W, Salomonsson EN, Aas FE, Forslund AL, Winther-Larsen HC, Maier J, Macellaro A, Kuoppa K, Oyston PC, Titball RW, Thomas RM, Forsberg Å, Prior JL, Koomey M. (2011) O-linked glycosylation of the PilA pilin protein of Francisella tularensis: identification of the endogenous protein-targeting oligosaccharyltransferase and characterization of the native oligosaccharide. J Bacteriol., 193, 5487-97. [PMID: 21804002] |
Author | Egge-Jacobsen W, Salomonsson EN, Aas FE, Forslund AL, Winther-Larsen HC, Maier J, Macellaro A, Kuoppa K, Oyston PC, Titball RW, Thomas RM, Forsberg Å, Prior JL, Koomey M |
Research Group | Department of Molecular Biosciences, University of Oslo, 0316 Oslo, Norway |
Corresponding Author | Koomey M |
Contact | Department of Molecular Biosciences, University of Oslo, 0316 Oslo, Norway |
Reference | Balonova L, Mann BF, Cerveny L, Alley WR Jr, Chovancova E, Forslund AL, Salomonsson EN, Forsberg A, Damborsky J, Novotny MV, Hernychova L, Stulik J. (2012) Characterization of protein glycosylation in Francisella tularensis subsp. holarctica: identification of a novel glycosylated lipoprotein required for virulence. Mol Cell Proteomics, 11(7), M111. [PMID: 22361235] |
Author | Lucie Balonova, Benjamin F. Mann, Lukas Cerveny, William R. Alley, Jr.,Eva Chovancova , Anna-Lena Forslund, Emelie N. Salomonsson, Åke Forsberg, Jiri Damborsky , Milos V. Novotny, Lenka Hernychova, and Jiri Stulik. |
Research Group | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic. |
Corresponding Author | Jiri Stulik. |
Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic. |