ProGP458 (ThuA)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP458 (ThuA) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Bacillales Family : Bacillaceae Genus : Bacillus Species : thuringiensis Strain : BGSC 4AW1 |
| Taxonomic ID (NCBI) | 1428 |
| Genome Information | |
| GenBank | NZ_MSFC01000028.1 |
| EMBL | CP012099 |
| Gene Information | |
| Gene Name | thuA |
| Protein Information | |
| Protein Name | ThuA |
| UniProtKB/SwissProt ID | C3GCL2 |
| NCBI RefSeq | WP_000661240.1 |
| EMBL-CDS | EEM68348.1 |
| UniProtKB Sequence | >tr|C3GCL2|C3GCL2_BACTU Uncharacterized protein OS=Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 GN=bthur0009_56250 PE=4 SV=1 MKELIKELNLEELETFEGGYDGVNYMHQHDGGGAGGGSGIGTAQCAYFKALCYSGGSEWL GGYGGCGSTQNNCELARKYC |
| Sequence length | 80 AA |
| Subcellular Location | Extracellular |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser) and S- (Cys) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | S19 and C28 |
| Glycosite(s) Annotated Protein Sequence | ">tr|C3GCL2|C3GCL2_BACTU Uncharacterized protein OS=Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 GN=bthur0009_56250 PE=4 SV=1 MKELIKELNLEELETFEGGYDGVNYMHQHDGGGAGGGSGIGTAQCAYFKALCYSGGS*(19)EWL GGYGGC*(28)GSTQNNCELARKYC" |
| Sequence Around Glycosites (21 AA) | YFKALCYSGGSEWLGGYGGCG GSEWLGGYGGCGSTQNNCELA |
| Technique(s) used for Glycosylated Residue(s) Detection | MALDI-TOF MS |
| Protein Glycosylation- Implication | All thurandacin analogs with different sugars displayed similar growth inhibitory activity, as indicated by agar diffusion assay. Thus, the stereochemistry of the hexose does not appear to be critical for bioactivity. |
| Glycan Information | |
| Glycan Annotation | Monosaccharide ( GlcNAc, Gal, Man) |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST ProGT ID | ProGT65 |
| Literature | |
| Year of Identification | 2014 |
| Year of Identification Month Wise | 2014.1.8 |
| Year of Validation | 2014 |
| Reference | Wang, H., Oman, T.J., Zhang, R., Garcia De Gonzalo, C.V., Zhang, Q. and Van Der Donk, W.A., 2014. The glycosyltransferase involved in thurandacin biosynthesis catalyzes both O-and S-glycosylation. Journal of the American Chemical Society, 136(1), pp.84-87. |
| Corresponding Author | Wilfred A. van der Donk |
| Contact | Howard Hughes Medical Institute and Roger Adams Laboratory, Department of Chemistry, University of Illinois at Urbana-Champaign , 600 South Mathews Avenue, Urbana, Illinois 61801, United States. |