ProGP503 (Uncharacterized protein)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP503 (Uncharacterized protein) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Acinetobacter nosocomialis |
| Domain | Bacteria |
| Classification | Family: Moraxellaceae Order: Pseudomonadales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 62977 |
| Genome Information | |
| GenBank | CR543861 |
| EMBL | CR543861 |
| Organism Additional Information | Non-pathogenic species |
| Protein Information | |
| Protein Name | Uncharacterized protein |
| UniProtKB/SwissProt ID | Q6F875 |
| NCBI RefSeq | WP_004924552.1 |
| EMBL-CDS | CAG69740.1 |
| UniProtKB Sequence | >tr|Q6F875|Q6F875_ACIAD Uncharacterized protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD3039 PE=4 SV=1 MLFKKIAIAAAIATTLAFVGCAKKTEEAAADANAAASQATAAASEAQAAVDASAASAPAS AAVAATAATDAAAAATDAAHAASAAASK |
| Sequence length | 88 AA |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | ZIC-HILIC for glycopeptide enrichment, multiple MS/MS fragmentation |
| Glycan Information | |
| Glycan Annotation | Pentasaccharide (HexNAc - HexNAc -HexNAc-HexNAc-HexNAc) |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PglLADP1 |
| OST ProGT ID | ProGT83 (PglLADP1) |
| Literature | |
| Reference | Harding, C.M., Nasr, M.A., Kinsella, R.L., Scott, N.E., Foster, L.J., Weber, B.S., Fiester, S.E., Actis, L.A., Tracy, E.N., Munson Jr, R.S. and Feldman, M.F., 2015. A cinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O‐glycosylation of multiple proteins. Molecular microbiology, 96(5), pp.1023-1041. |
| Corresponding Author | Mario F Feldman |
| Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. |
| Reference | Harding CM, Nasr MA, Kinsella RL, Scott NE, Foster LJ, Weber BS, Fiester SE, Actis LA, Tracy EN, Munson RS Jr, Feldman MF. (2015) . Acinetobacter strains carry two functional oligoligoligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O-glycosylation of multiple proteins. Mol Microbiol. 5, 1023-41. [PMID: 25727908] |
| Author | Harding CM, Nasr MA, Kinsella RL, Scott NE, Foster LJ, Weber BS, Fiester SE, Actis LA, Tracy EN, Munson RS Jr, Feldman MF. |
| Research Group | 1 Center for Microbial Pathogenesis, The Research Institute at Nationwide Childrens Hospital, Columbus, OH, USA. 2 Department of Pediatrics, College of Medicine, The Ohio State University, Columbus, OH, USA. 3 Biomedical Sciences Graduate Program, College of Medicine, The Ohio State University, Columbus, OH, USA. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. 5 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 6 Department of Microbiology, Miami University, Oxford, OH, USA |
| Corresponding Author | Feldman MF. |
| Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. |