ProGP525 (Hypothetical signal peptide protein)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP525 (Hypothetical signal peptide protein) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Ralstonia solanacearum GMI1000 |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Betaproteobacteria Orders : Burkholderiales Family : Burkholderiaceae Genus : Ralstonia Species : solanacearum Strain : GMI1000 |
| Taxonomic ID (NCBI) | 267608 |
| Genome Information | |
| GenBank | NC_003295.1 |
| EMBL | AL646052.1 |
| Gene Information | |
| Gene Name | RSc2491 |
| NCBI Gene ID | 1221338 |
| GenBank Gene Sequence | NC_003295.1 |
| Protein Information | |
| Protein Name | Hypothetical signal peptide protein |
| UniProtKB/SwissProt ID | Q8XWI3 |
| NCBI RefSeq | WP_011002408.1 |
| EMBL-CDS | CAD16198.1 |
| UniProtKB Sequence | >tr|Q8XWI3|Q8XWI3_RALSO Hypothetical signal peptide protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2491 PE=4 SV=1 MKKLIAALIAGLFATGVFAQASAPAAEAAAPAAEKAAPKKAKKAKKHHAKKEKAAAADAA SAPAAKQ |
| Sequence length | 67 AA |
| Function | Hypothetical signal peptide protein |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | S61 |
| Glycosite(s) Annotated Protein Sequence | >tr|Q8XWI3|Q8XWI3_RALSO Hypothetical signal peptide protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2491 PE=4 SV=1 MKKLIAALIAGLFATGVFAQASAPAAEAAAPAAEKAAPKKAKKAKKHHAKKEKAAAADAA S*(61)APAAKQ |
| Sequence Around Glycosites (21 AA) | KEKAAAADAASAPAAKQ |
| Technique(s) used for Glycosylation Detection | ZIC-HILIC |
| Technique(s) used for Glycosylated Residue(s) Detection | LC-MS, CID MS/MS and HCD MS/MS |
| Glycan Information | |
| Glycan Annotation | Pentasaccharide (HexNAc-(Pen)-dHex3) |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PglLRs |
| OST ProGT ID | ProGT104 |
| Literature | |
| Year of Identification | 2016 |
| Year of Identification Month Wise | 2016.3.26 |
| Year of Validation | 2016 |
| Reference | Elhenawy, W., Scott, N.E., Tondo, M.L., Orellano, E.G., Foster, L.J. and Feldman, M.F., 2016. Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology, 26(3), pp.301-311. |
| Corresponding Author | Mario F Feldman |
| Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |