ProGP537 (Peptidyl-prolyl cis-trans isomerase)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP537 (Peptidyl-prolyl cis-trans isomerase) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Ralstonia solanacearum GMI1000 |
Domain | Bacteria |
Classification | Family:Burkholderiaceae Order: Burkholderiales Class: Betaproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 267608 |
Genome Information | |
GenBank | NC_003295.1 |
EMBL | AL646052.1 |
Gene Information | |
Gene Name | RSc1565 |
NCBI Gene ID | 1220396 |
GenBank Gene Sequence | NC_003295.1 |
Protein Information | |
Protein Name | Peptidyl-prolyl cis-trans isomerase |
UniProtKB/SwissProt ID | Q8XZ41 |
NCBI RefSeq | WP_011001509.1 |
EMBL-CDS | CAD15267.1 |
UniProtKB Sequence | >tr|Q8XZ41|Q8XZ41_RALSO Peptidyl-prolyl cis-trans isomerase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1565 PE=3 SV=1 MKRLSLLLCATSLALAAYNVQAASAVSAAPAESLPSGVTIQHVAKGSGPSPKATDTVKVH YRGTLADGTEFDSSYKRGQPISFPLNRVIPCWTEGVQKMQVGGKAKLTCPPATAYGARGV PGTIPPNATLNFEVELLGIGG |
Sequence length | 141 AA |
Function | PROTEIN FOLDING |
Glycosylation Status | |
Glycosylation Type | O- (Ser/Thr) linked |
Technique(s) used for Glycosylation Detection | ZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS |
Glycan Information | |
Glycan Annotation | Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains. |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | PglLRs |
OST ProGT ID | ProGT104 (PglLRs) |
Literature | |
Reference | Elhenawy, W., Scott, N.E., Tondo, M.L., Orellano, E.G., Foster, L.J. and Feldman, M.F., 2016. Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology, 26(3), pp.301-311. |
Corresponding Author | Mario F Feldman |
Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |
Reference | Elhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228] |
Author | Elhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. |
Research Group | 1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Faculty of Biochemical and Pharmaceutical Sciences (FBIOYF-UNR), Institute of Molecular and Cellular Biology of Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |
Corresponding Author | Feldman MF |
Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |