ProGP537 (Peptidyl-prolyl cis-trans isomerase)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP537 (Peptidyl-prolyl cis-trans isomerase) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Ralstonia solanacearum GMI1000 |
| Domain | Bacteria |
| Classification | Family:Burkholderiaceae Order: Burkholderiales Class: Betaproteobacteria Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 267608 |
| Genome Information | |
| GenBank | NC_003295.1 |
| EMBL | AL646052.1 |
| Gene Information | |
| Gene Name | RSc1565 |
| NCBI Gene ID | 1220396 |
| GenBank Gene Sequence | NC_003295.1 |
| Protein Information | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase |
| UniProtKB/SwissProt ID | Q8XZ41 |
| NCBI RefSeq | WP_011001509.1 |
| EMBL-CDS | CAD15267.1 |
| UniProtKB Sequence | >tr|Q8XZ41|Q8XZ41_RALSO Peptidyl-prolyl cis-trans isomerase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1565 PE=3 SV=1 MKRLSLLLCATSLALAAYNVQAASAVSAAPAESLPSGVTIQHVAKGSGPSPKATDTVKVH YRGTLADGTEFDSSYKRGQPISFPLNRVIPCWTEGVQKMQVGGKAKLTCPPATAYGARGV PGTIPPNATLNFEVELLGIGG |
| Sequence length | 141 AA |
| Function | PROTEIN FOLDING |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | ZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS |
| Glycan Information | |
| Glycan Annotation | Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains. |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PglLRs |
| OST ProGT ID | ProGT104 (PglLRs) |
| Literature | |
| Reference | Elhenawy, W., Scott, N.E., Tondo, M.L., Orellano, E.G., Foster, L.J. and Feldman, M.F., 2016. Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology, 26(3), pp.301-311. |
| Corresponding Author | Mario F Feldman |
| Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |
| Reference | Elhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228] |
| Author | Elhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. |
| Research Group | 1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Faculty of Biochemical and Pharmaceutical Sciences (FBIOYF-UNR), Institute of Molecular and Cellular Biology of Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |
| Corresponding Author | Feldman MF |
| Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |