ProGP674 (Hypothetical protein)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP674 (Hypothetical protein) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Pyrobaculum calidifontis JCM 11548 |
Domain | Archaea |
Classification | Family:Thermoproteaceae Order: Thermoproteales Class:Thermoprotei Division or phylum: "Crenarchaeota" |
Taxonomic ID (NCBI) | 410359 |
Genome Information | |
GenBank | CP000561.1 |
EMBL | CP000561 |
Organism Additional Information | Pyrobaculum calidifontis is a hyperthermophilic archaeon that belongs to the phylum Crenarchaeota. In contrast to the phylum Euryarchaeota, only the N-glycan structure of the genus Sulfolobus is known in Crenarchaeota. |
Gene Information | |
Gene Name | Pcal_1437 |
Protein Information | |
Protein Name | Hypothetical protein |
UniProtKB/SwissProt ID | A3MW40 |
NCBI RefSeq | ABO08857.1. |
EMBL-CDS | ABO08857.1. |
UniProtKB Sequence | >tr|A3MW40|A3MW40_PYRCJ Uncharacterized protein OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_1437 PE=4 SV=1 MSTEERLLKALESPKTQEALAEIVERIDVLRDLVRTLWEFKRSGVLDDLLQLATTLRFIT EGLLTPGFIEKVAKLQEVALTAAVNMSQDTSKLDCLTTAVAVAEVEKPIGLMGLLAALRD PDVQRGLGYLVSLLKQLGKCMEKRY |
Sequence length | 145 AA |
Glycosylation Status | |
Glycosylation Type | N- (Asn) linked |
Technique(s) used for Glycosylation Detection | ConA(Concanavalin A) lectin affinity chromatography , and detected by periodic acid-Schiff (PAS) staining and Coomassie Brilliant Blue (CBB) staining on sodium dodecyl sulphate?polyacrylamide gel electrophoresis (SDS?PAGE) gels, NMR spectroscopy |
Technique(s) used for Glycosylated Residue(s) Detection | Normal-phase-HPLC-MS/MS analysis , LC-ESI-MS/MS analysis |
Glycan Information | |
Glycan Annotation | Pentasaccharide (?-Man-(1-3)-(?-Man-(1-6)-)?-Man-(1-4)-?-GlcANAc3NAc-(1-4)-?-GlcNAc3NAc) |
GlyTouCan | G06484YZ G62526ZK |
Literature | |
Year of Identification | 2017 |
Year of Validation | 2017 |
Reference | Fujinami D, Taguchi Y, Kohda D.(2017) Asn-linked oligosaccharide chain of a crenarchaeon, Pyrobaculum calidifontis, is reminiscent of the eukaryotic high-mannose-type glycan. Glycobiology, 16. [PubMed: 28510654] |
Author | Fujinami D, Taguchi Y, Kohda D |
Research Group | 1 Division of Structural Biology, Medical Institute of Bioregulation, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. 2 Research Center for Advanced Immunology, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. 3 Research Center for Live-Protein Dynamics, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. |
Corresponding Author | Kohda D |
Contact | 1 Division of Structural Biology, Medical Institute of Bioregulation, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. 2 Research Center for Advanced Immunology, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. 3 Research Center for Live-Protein Dynamics, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan. |