ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Paenibacillus (Bacillus) amyloliquefaciens (velezensis) and Bacillus macerans |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Bacillales Family : Bacillaceae Genus : Paenibacillus Species : amyloliquefaciens |
| Taxonomic ID (NCBI) | 1390 |
| Genome Information | |
| GenBank | M15674 |
| EMBL | M15674 |
| Gene Information | |
| Gene Name | bglA |
| Protein Information | |
| Protein Name | H(A107-M) (1,3-1,4)-beta-glucanase |
| UniProtKB/SwissProt ID | P07980 |
| EMBL-CDS | AAA87323.1 |
| UniProtKB Sequence | >sp|P07980|GUB_BACAM Beta-glucanase OS=Bacillus amyloliquefaciens GN=bglA PE=3 SV=1 MKRVLLILVTGLFMSLCGITSSVSAQTGGSFFEPFNSYNSGLWQKADGYSNGDMFNCTWR ANNVSMTSLGEMRLALTSPSYNKFDCGENRSVQTYGYGLYEVRMKPAKNTGIVSSFFTYT GPTEGTPWDEIDIEFLGKDTTKVQFNYYTNGAGNHEKFADLGFDAANAYHTYAFDWQPNS IKWYVDGQLKHTATTQIPAAPGKIMMNLWNGTGVDDWLGSYNGVNPIYAHYDWMRYRKK |
| Sequence length | 239 AA |
| Subcellular Location | Secreted |
| Function | Catalyses cleavage of (1,4)-beta-linkages of O-substituted beta-D-glucanopyranosyl residues. |
| Glycosylation Status | |
| Technique(s) used for Glycosylation Detection | Carbohydrate content determination with GLC |
| Glycan Information | |
| Glycan Annotation | The relative molar content of monosaccharides: N-acetylglucosamine 1.0, mannose 4.9, galactose 2.1, glucose 5.5. The relative content of mannose and N-acetylglucosamine indicates the presence of oligomannose or hybrid-type oligosaccharides and the presence of galactose possibly indicates either O-linked or hybrid-types oligosaccharides. Addition of an N-linked oligosaccharide corresponding to an increase in apparent molecular mass of 3 kDa. |
| Protein Glycosylation linked (PGL) gene(s) | |
| Additional Comment | Engineered glycoprotein. The glucanases from which the hybrid enzyme is made, are not glycosylated in their native hosts. So the hybrid enzyme (214 AA) containing 107 amino acids from Bacillus amyloliquefaciens (1,3-1,4)-beta-glucanase (AMY), and 107 residues from B. macerans (1,3-1,4)-beta-glucanase (MAC), is glycosylated in Saccharomyces cerevisiae to observe its effect on the thermostability of the enzyme. Signal peptide is from MAC. UniProtKB ID of MAC is P23904 and that of AMY is P07980. UniProtKB and EMBL information has been included for AMY. |
| Literature | |
| Year of Identification | 1991 |
| Year of Identification Month Wise | 1991.01 |
| Reference | Meldgaard, M., 1994. Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1, 3-1, 4)-β-glucanases secreted from yeast. Microbiology, 140(1), pp.159-166. |
| Corresponding Author | Morten Meldgaard |
| Contact | Department of Physiology, Carlsberg Laboratory, Copenhagen, Denmark. |
| Reference | Olsen, O. and Thomsen, K.K., 1991. Improvement of bacterial β-glucanase thermostability by glycosylation. Microbiology, 137(3), pp.579-585. |
| Corresponding Author | Karl KristianThomesen |
| Contact | Carlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark |