ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Paenibacillus (Bacillus) amyloliquefaciens (velezensis) and Bacillus macerans |
Domain | Bacteria |
Classification | Family: Bacillaceae Order: Bacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" |
Taxonomic ID (NCBI) | 1390 |
Genome Information | |
GenBank | M15674 |
EMBL | M15674 |
Gene Information | |
Gene Name | bglA |
Protein Information | |
Protein Name | H(A107-M) (1,3-1,4)-beta-glucanase |
UniProtKB/SwissProt ID | P07980 |
EMBL-CDS | AAA87323.1 |
UniProtKB Sequence | >sp|P07980|GUB_BACAM Beta-glucanase OS=Bacillus amyloliquefaciens GN=bglA PE=3 SV=1 MKRVLLILVTGLFMSLCGITSSVSAQTGGSFFEPFNSYNSGLWQKADGYSNGDMFNCTWR ANNVSMTSLGEMRLALTSPSYNKFDCGENRSVQTYGYGLYEVRMKPAKNTGIVSSFFTYT GPTEGTPWDEIDIEFLGKDTTKVQFNYYTNGAGNHEKFADLGFDAANAYHTYAFDWQPNS IKWYVDGQLKHTATTQIPAAPGKIMMNLWNGTGVDDWLGSYNGVNPIYAHYDWMRYRKK |
Sequence length | 239 AA |
Subcellular Location | Secreted |
Function | Catalyses cleavage of (1,4)-beta-linkages of O-substituted beta-D-glucanopyranosyl residues. |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | Carbohydrate content determination with GLC |
Glycan Information | |
Glycan Annotation | The relative molar content of monosaccharides: N-acetylglucosamine 1.0, mannose 4.9, galactose 2.1, glucose 5.5. The relative content of mannose and N-acetylglucosamine indicates the presence of oligomannose or hybrid-type oligosaccharides and the presence of galactose possibly indicates either O-linked or hybrid-types oligosaccharides. Addition of an N-linked oligosaccharide corresponding to an increase in apparent molecular mass of 3 kDa. |
Literature | |
Year of Identification | 1991 |
Year of Identification Month Wise | 1991.01 |
Reference | Meldgaard, M. and Svendsen, I. (1994) Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1,3-1,4)-beta-glucanases secreted from yeast. Microbiology, 140 ( Pt 1), 159-166. [PubMed: 8162185] |
Author | Svendsen, I. |
Research Group | Department of Physiology, Carlsberg Laboratory, Copenhagen, Denmark. |
Corresponding Author | Meldgaard, M. Svendsen, I. |
Contact | Department of Physiology, Carlsberg Laboratory, Copenhagen, Denmark. |
Reference | Olsen, O., Thomesen, K. K. (1991) Improvement of bacterial P-glucanase thermostability by glycosylation. J Gen Microbiol, 137, 579–585. |
Author | Olsen, O., Thomesen, K. K. |
Research Group | Carlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark |
Corresponding Author | Thomesen, K. K. |
Contact | Carlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark |