| Organism Information |
| Organism Name | Streptococcus parasanguinis FW213 |
| Domain | Bacteria |
| Phylum | Firmicutes |
| Classification | Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes" |
| Taxonomic ID (NCBI) | 1114965 |
| Genome Information |
| Gene Bank | CP003122.1 |
| EMBL | CP003122.1 |
| Gene Information |
| Gene Name | Gly |
| Protein information |
| Protein Name | Gly |
| UniProtKB/ SwissProt ID | I1ZPA3 |
| NCBI Ref Seq | AFJ26877.1 |
| UniProtKB Sequence | >tr|I1ZPA3|I1ZPA3_STRPA Putative glycosyltransferase (Gly) OS=Streptococcus parasanguinis FW213 GN=gly PE=4 SV=1
MIRRVMEKISVIIPAYNAEKYLEQCVESVRTQIYNNIEIIIVNDGSTDRTAEIIERLKEK
DSRIRTLHKRINEGIGATRNSALELVTGQYILFLDSDDWIDPNHISDLYNLLVRTDSDVS
IANFTRYIESDNRYEIHITDDDYYEQIFTPQEWFTYQYGKPHNLSLCFTVPWGKLYKRSL
FDNILYYTGPFGEDDRTTWKLYLVADKIAYMHRSTMVYRVNGESLTQTTERSEVFSVEPV
LERLALLSMLGFDLKNEIAAFDWRANLVKNISLANGNVELYKELQFQLNMIEKYRKN |
| EMBL CDS | AFJ26877.1 |
| Sequence length | 297 AA |
| Glycosylation Information |
| CAZY Family | GT2 |
| EC Number (BRENDA) | 2.4.99.18 |
| Sugar Donor Specificity | UDP-Glucose or UDP-Galactose |
| Experimental Validation | In vivo and In vitro |
| Donor Specificity | UDP-Glucose or UDP-Galactose |
| Additional Information | 1) Gly is a glucosyltransferase mediating the final step of Fap1 glycosylation.
2) Gly can transfer Glucose and Galactose, in vitro on Fap1 but it has higher activity toward transferring glucose.
 |
| Litrature |
| Year Of Validation | 2009Â |
| Reference | Mistou, M. Y., Dramsi, S., Brega, S., Poyart, C., & Trieu-Cuot, P. (2009). Molecular dissection of the secA2 locus of group B Streptococcus reveals that glycosylation of the Srr1 LPXTG protein is required for full virulence. Journal of bacteriology, 191(13), 4195-4206.
|
| Authors | Mistou, M. Y., Dramsi, S., Brega, S., Poyart, C., & Trieu-Cuot, P.
|
| Research groups | Institut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France.
|
| Corresponding Author | Trieu-Cuot, P.
|
| Contacts | Institut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France.
|
| Reference | Chaze, T., Guillot, A., Valot, B., Langella, O., Chamot-Rooke, J., Di Guilmi, A.M., Trieu-Cuot, P., Dramsi, S. & Mistou, M. Y. (2014). O-glycosylation of the N-terminal region of the serine-rich adhesin Srr1 of Streptococcus agalactiae explored by mass spectrometry. Molecular & Cellular Proteomics, mcp-M114.
|
| Authors | Chaze, T., Guillot, A., Valot, B., Langella, O., Chamot-Rooke, J., Di Guilmi, A.M., Trieu-Cuot, P., Dramsi, S. & Mistou, M. Y.
|
| Research groups | 1 INRA MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France; AgroParisTech, MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France. Shepherd Institute, Mass Spectrometry and Proteomics Structural Unit, 28 rue du Dr. Roux, 75015 Paris, France
2 INRA, PAPPSO, MICALIS UMR-1319, 78352 Jouy en Josas cedex, France
3INRA, PAPPSO, Plant Genetics UMR-320, Ferme du Moulon, 91190 Gif sur Yvette, France;
4 Shepherd Institute, Mass Spectrometry and Proteomics Structural Unit, 28 rue du Dr. Roux, 75015 Paris, France; CNRS UMR 3528, Pasteur Institute, 28 rue du Dr. Roux, 75015 Paris, Francee
5 CEA, Institute of Structural Biology Jean-Pierre Ebel, F-38027 Grenoble, France
6 Institut Pasteur Bacteria Biology of Pathogenic Gram +, 28, rue du Dr Roux, 75015 Paris, France; Centre National Center for Scientific Research, CNRS ERL3526, Paris, France
7 INRA MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France
|
| Corresponding Author | Mistou, M. Y.
|
| Contacts | INRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France
|
