Update (2022 release) in progress


ProGT1 (PilO)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT1 (PilO)
ProGT Pathway
Organism Information
Organism NamePseudomonas aeruginosa 1244
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)287
Genome Information
Gene BankNC_002516.2
Gene Information
Gene NamepilO
NCBI Gene ID880985
Protein information
Protein NamePilO 
UniProtKB/ SwissProt IDA0A1U9XPN7
NCBI Ref SeqWP_003104917.1
UniProtKB Sequence>tr|A0A1U9XPN7|A0A1U9XPN7_PSEAI Oligosaccharyl transferase OS=Pseudomonas aeruginosa GN=pilO PE=4 SV=1 MRMWLAWERMDRVLRTILLLLISILLLSPIVYCGVSDNWHDQQRILQLVVLSGSSLLLLF SFPLPFARRMVQVTLLVILGLGSVSAFLSANPSWAFKEWSVFAGLMLFSFNISASPEWVR RIALWGLVVLGGFFCYQFLLSYLAAFVSGLRELNPRVLLSGFSNVRTMGQFQAMLLPLMA ALGLYLRETGRFRLSRLVMLLLAIQWCISFALAGRGLWLGFAVAHLALCWIGPVGRRFLI VQLSAVFVGLALYFLLMVALPTWLGIDMTLMSGMRSGLSLRDVLWRDAWGMFVAHPLLGV GPMHFSAVPNSVGAHPHQMLLQWFAEWGGVAGLLVVGLMILGLLRGARYLREQGDSMDAG LWLALVSVLVLAQVDGVFVMPFTQTVLALLVGIAMARWSKPVAPSPAQRWLCRGLAVVVI VVLGRVLLLEVPGLTAAEERYLEIHGGGEAPRFWIQGWIPM
EMBL CDSAQZ26225
Sequence length461 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) PilO required for pilin glycosylation and the glycosylated pilin act as a significant virulence factor during infection.
Potential Application1) PilO has relaxed specificity and can transfer the variety of glycans on acceptor substrate, this non-specific behavior of enzyme can use to design conjugate vaccines.
Additional Information1) PilO can transfer a variety of carbohydrates (only short glycan chains) other than their endogenous glycans to acceptor proteins in E.coli.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGTNC
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Carboxy-terminal serine
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Trisaccharide
Accessory GT IDProGT1.1ProGT1.2
Glycan Information
Glycan transferredTrisaccharide (alpha-5NBetaOHC(4)7NFmPse-(2-->4)Beta-Xyl-(1-->3)-Beta-FuNAc) 
Method of Glycan IndentificationMALDI-TOF, FT ICR, and nanoESI QTOF MS
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name PilA
ProGPdb ID ProGP230
Litrature
Year Of Validation1995 
Reference Castric, P. (1995). pilO, a gene required for glycosylation of Pseudomonas aeruginosa 1244 pilin. Microbiology, 141(5), 1247-1254.

Authors Castric, P.
Research groupsDepartment of Biological Sciences, Duquesne University, Pittsburgh, Pennsylvania 15282, USA.
Corresponding AuthorCastric, P.
ContactsDepartment of Biological Sciences, Duquesne University, Pittsburgh, Pennsylvania 15282, USA.
Reference Faridmoayer, A., Fentabil, M. A., Mills, D. C., Klassen, J. S., & Feldman, M. F. (2007). Functional characterization of bacterial oligosaccharyltransferases involved in O-linked protein glycosylation. Journal of bacteriology, 189(22), 8088-8098.

Authors Faridmoayer, A., Fentabil, M. A., Mills, D. C., Klassen, J. S., & Feldman, M. F.
Research groupsAlberta Ingenuity Centre for Carbohydrate Science, Canada
Corresponding Author Feldman, M. F.
ContactsAlberta Ingenuity Centre for Carbohydrate Science, Canada
Reference Qutyan, M., Paliotti, M., & Castric, P. (2007). PilO of Pseudomonas aeruginosa 1244: subcellular location and domain assignment. Molecular microbiology, 66(6), 1444-1458.

Authors Qutyan, M., Paliotti, M., & Castric, P.
Research groupsAlberta Ingenuity Centre for Carbohydrate Science, Canada
Corresponding Author Castric, P.
ContactsDepartment of Biological Sciences, Duquesne University, Pittsburgh, PA 15282, USA.
Reference Sampaleanu, L. M., Bonanno, J. B., Ayers, M., Koo, J., Tammam, S., Burley, S. K., ... & Howell, P. L. (2009). Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex. Journal of molecular biology, 394(1), 143-159.

Authors Sampaleanu, L. M., Bonanno, J. B., Ayers, M., Koo, J., Tammam, S., Burley, S. K., ... & Howell, P. L.
Research groupsProgram in Molecular Structure and Function, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario, Canada M5G 1X8
Corresponding Author Howell, P. L.
ContactsProgram in Molecular Structure and Function, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario, Canada M5G 1X8
Reference Qutyan, M., Henkel, M., Horzempa, J., Quinn, M., & Castric, P. (2010). Glycosylation of pilin and nonpilin protein constructs by Pseudomonas aeruginosa 1244. Journal of bacteriology, 192(22), 5972-5981.

Authors Qutyan, M., Henkel, M., Horzempa, J., Quinn, M., & Castric, P.
Research groupsProgram in Molecular Structure and Function, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario, Canada M5G 1X8
Corresponding Author Castric, P.
ContactsDepartment of Biological Sciences, Duquesne University, Pittsburgh, PA 15282, USA.