| Organism Information |
| Organism Name | Pseudomonas aeruginosa 1244 |
| Clinical Implication | Pathogenic |
| Domain | Bacteria |
| Phylum | Proteobacteria |
| Classification | Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 287 |
| Genome Information |
| Gene Bank | NC_002516.2 |
| Gene Information |
| Gene Name | pilO |
| NCBI Gene ID | 880985 |
| Protein information |
| Protein Name | PilOÂ |
| UniProtKB/ SwissProt ID | A0A1U9XPN7 |
| NCBI Ref Seq | WP_003104917.1 |
| UniProtKB Sequence | >tr|A0A1U9XPN7|A0A1U9XPN7_PSEAI Oligosaccharyl transferase OS=Pseudomonas aeruginosa GN=pilO PE=4 SV=1
MRMWLAWERMDRVLRTILLLLISILLLSPIVYCGVSDNWHDQQRILQLVVLSGSSLLLLF
SFPLPFARRMVQVTLLVILGLGSVSAFLSANPSWAFKEWSVFAGLMLFSFNISASPEWVR
RIALWGLVVLGGFFCYQFLLSYLAAFVSGLRELNPRVLLSGFSNVRTMGQFQAMLLPLMA
ALGLYLRETGRFRLSRLVMLLLAIQWCISFALAGRGLWLGFAVAHLALCWIGPVGRRFLI
VQLSAVFVGLALYFLLMVALPTWLGIDMTLMSGMRSGLSLRDVLWRDAWGMFVAHPLLGV
GPMHFSAVPNSVGAHPHQMLLQWFAEWGGVAGLLVVGLMILGLLRGARYLREQGDSMDAG
LWLALVSVLVLAQVDGVFVMPFTQTVLALLVGIAMARWSKPVAPSPAQRWLCRGLAVVVI
VVLGRVLLLEVPGLTAAEERYLEIHGGGEAPRFWIQGWIPM
|
| EMBL CDS | AQZ26225 |
| Sequence length | 461 AA |
| Subcellular Location | Membrane (Integral component of membrane) |
| Function in Native Organism | 1) PilO required for pilin glycosylation and the glycosylated pilin act as a significant virulence factor during infection. |
| Potential Application | 1) PilO has relaxed specificity and can transfer the variety of glycans on acceptor substrate, this non-specific behavior of enzyme can use to design conjugate vaccines. |
| Additional Information | 1) PilO can transfer a variety of carbohydrates (only short glycan chains) other than their endogenous glycans to acceptor proteins in E.coli. |
| Glycosyltransferase Information |
| Glycosylation Type | O- (Ser/Thr) linked |
| CAZY Family | GTNC |
| EC Number (BRENDA) | 2.4.1.- |
| Mechanism of Glycan Transfer | En bloc |
| Acceptor specificity Sequon_1 | Carboxy-terminal serine |
| Donor Type | Lipid linked sugars |
| Donor Specificity | UndPP-Trisaccharide |
| Accessory GT ID | ProGT1.1ProGT1.2 |
| Glycan Information |
| Glycan transferred | Trisaccharide (alpha-5NBetaOHC(4)7NFmPse-(2-->4)Beta-Xyl-(1-->3)-Beta-FuNAc)Â |
| Method of Glycan Indentification | MALDI-TOF, FT ICR, and nanoESI QTOF MS |
| Experimental_strategies | In vivo |
| Acceptor Subtrate Information |
| Acceptor Substrate name | PilA |
| ProGPdb ID | ProGP230 |
| Litrature |
| Year Of Validation | 1995Â |
| Reference | Castric, P. (1995). pilO, a gene required for glycosylation of Pseudomonas aeruginosa 1244 pilin. Microbiology, 141(5), 1247-1254.
|
| Authors | Castric, P.
|
| Research groups | Department of Biological Sciences, Duquesne University, Pittsburgh, Pennsylvania 15282, USA.
|
| Corresponding Author | Castric, P.
|
| Contacts | Department of Biological Sciences, Duquesne University, Pittsburgh, Pennsylvania 15282, USA.
|
| Reference | Faridmoayer, A., Fentabil, M. A., Mills, D. C., Klassen, J. S., & Feldman, M. F. (2007). Functional characterization of bacterial oligosaccharyltransferases involved in O-linked protein glycosylation. Journal of bacteriology, 189(22), 8088-8098.
|
| Authors | Faridmoayer, A., Fentabil, M. A., Mills, D. C., Klassen, J. S., & Feldman, M. F.
|
| Research groups | Alberta Ingenuity Centre for Carbohydrate Science, Canada
|
| Corresponding Author | Feldman, M. F.
|
| Contacts | Alberta Ingenuity Centre for Carbohydrate Science, Canada
|
| Reference | Qutyan, M., Paliotti, M., & Castric, P. (2007). PilO of Pseudomonas aeruginosa 1244: subcellular location and domain assignment. Molecular microbiology, 66(6), 1444-1458.
|
| Authors | Qutyan, M., Paliotti, M., & Castric, P.
|
| Research groups | Alberta Ingenuity Centre for Carbohydrate Science, Canada
|
| Corresponding Author | Castric, P.
|
| Contacts | Department of Biological Sciences, Duquesne University, Pittsburgh, PA 15282, USA.
|
| Reference | Sampaleanu, L. M., Bonanno, J. B., Ayers, M., Koo, J., Tammam, S., Burley, S. K., ... & Howell, P. L. (2009). Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex. Journal of molecular biology, 394(1), 143-159.
|
| Authors | Sampaleanu, L. M., Bonanno, J. B., Ayers, M., Koo, J., Tammam, S., Burley, S. K., ... & Howell, P. L.
|
| Research groups | Program in Molecular Structure and Function, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario, Canada M5G 1X8
|
| Corresponding Author | Howell, P. L.
|
| Contacts | Program in Molecular Structure and Function, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario, Canada M5G 1X8
|
| Reference | Qutyan, M., Henkel, M., Horzempa, J., Quinn, M., & Castric, P. (2010). Glycosylation of pilin and nonpilin protein constructs by Pseudomonas aeruginosa 1244. Journal of bacteriology, 192(22), 5972-5981.
|
| Authors | Qutyan, M., Henkel, M., Horzempa, J., Quinn, M., & Castric, P.
|
| Research groups | Program in Molecular Structure and Function, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario, Canada M5G 1X8
|
| Corresponding Author | Castric, P.
|
| Contacts | Department of Biological Sciences, Duquesne University, Pittsburgh, PA 15282, USA.
|
