
Organism Information |
Organism Name | Streptomyces coelicolor strain J1929 |
Clinical Implication | Plant pathogens |
Domain | Bacteria |
Phylum | Actinobacteria |
Classification | Family: Streptomycetaceae Suborder: Streptomycineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" |
Taxonomic ID (NCBI) | 100226 |
Genome Information |
Gene Bank | AL939115.1 |
EMBL | AL939115.1 |
Gene Information |
Gene Name | SCO3154 |
NCBI Gene ID | 1098588 |
Protein information |
Protein Name | Pmt |
UniProtKB/ SwissProt ID | Q9RKD3 |
NCBI Ref Seq | NP_627370.1 |
UniProtKB Sequence | >tr|Q9RKD3|Q9RKD3_STRCO Putative integral membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3154 PE=4 SV=1
MHSAVPYDGAVTSTASSTDTLHDQAPHDERPTWQQRLRRFGYPAGPATGDVRDRLVPPYT
SPSPRLWAFLGVSKPLTDRMIRWSAWGGPLLVALFAGVLRFWNLGSPKAVIFDETYYAKD
AWALIHRGFEVNWDKNANDLILNSGGDVPIPTDAAYVVHPPVGKYIIGLGELLFGFDPFG
WRFMTALLGTLSVLLLCRIGRRLFRSTFLGCLAGALMALDGLHFVMSRTALLDSVLMFFV
LAAFGCLVVDRDKARSRLAAALPVDEDGRVRPDAHVAETLRLGWRPWRLAAGLMLGLAAA
TKWNGLYIMAAFCVMAVLWDVGSRRVAGAHRPYRAVLRHDLGWAFLSTVPVALATYLLSW
LGWILSPSDGTGGYYRDWATKDGANSSWSWLFPDWWRSLWHYETQVLEFHTHLTSPHTYQ
SNPWSWIVLGRPVSYFYESPSAGSDGCPVDAGEKCAREVLALGTPLLWWVGCFALLYVLW
RWLFRRDWRAGAIACGVAAGYLPWFMYQERTIFLFYAVVFLPFLCLAVAMLLGAIIGRPG
CTDTRRVAGATGAGVLVLLIAWNFIYFWPLYTGTAIPMEEWRARMWLDTWV
|
EMBL CDS | CAB59650.1 |
Sequence length | 591 AA |
Subcellular Location | Membrane |
Function in Native Organism | 1) Pmt transfer the mannose sugar to PstS Protein. 2) Streptomyces coelicolor protein mannosyltransferase (Pmt) is required for glycosylation of the Apa protein. |
String | 100226.SCO3154. |
Additional Information | 1) PMTs are functional orthologues of the PMTs in fungi and POMTs in humans. 2) Streptomyces coelicolor Ppm and Pmt also modify the Apa protein of M.tb. |
Glycosyltransferase Information |
Glycosylation Type | O- (Ser/Thr) linked |
CAZY Family | GT39 |
EC Number (BRENDA) | 2.4.1.- |
Mechanism of Glycan Transfer | Sequential |
Donor Type | Nucleotide activated sugars |
Donor Specificity | GDP-Mannose |
Accessory GT ID | ProGT35.1 |
Glycan Information |
Glycan transferred | Trihexose |
Method of Glycan Indentification | Nano-LC-ESI-MS/MS |
Experimental_strategies | In vitro and In vivo  |
Acceptor Subtrate Information |
Acceptor Substrate name | PstS |
ProGPdb ID | ProGP309 |
Acceptor Substrate name | Apa |
ProGPdb ID | ProGP51 |
Litrature |
Year Of Validation | 2009Â |
Reference | Wehmeier, S., Varghese, A.S., Gurcha, S.S., Tissot, B., Panico, M., Hitchen, P., Morris, H.R., Besra, G.S., Dell, A. & Smith, M. C. M. (2009). Glycosylation of the phosphate binding protein, PstS, in Streptomyces coelicolor by a pathway that resembles protein O?mannosylation in eukaryotes. Molecular microbiology, 71(2), 421-433.
|
Authors | Wehmeier, S., Varghese, A.S., Gurcha, S.S., Tissot, B., Panico, M., Hitchen, P., Morris, H.R., Besra, G.S., Dell, A. & Smith, M. C. M.
|
Research groups | School of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK.
|
Corresponding Author | Smith, M. C. M.
|
Contacts | School of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK.
|
Reference | Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L. (2014). Lipoprotein N-acyl transferase (Lnt1) is dispensable for protein O-mannosylation by Streptomyces coelicolor. FEMS microbiology letters, 350(1), 72-82.
|
Authors | Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L.
|
Research groups | School of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK.
|
Corresponding Author | Servín-González, L.
|
Contacts | Department of Molecular Biology and Biotechnology, Biomedical Research Institute, National Autonomous University of Mexico, Ciudad Universitaria, Mexico City, DF, Mexico.
|