| Organism Information |
| Organism Name | Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) |
| Clinical Implication | Pathogenic |
| Domain | Bacteria |
| Phylum | Firmicutes |
| Classification | Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes" |
| Taxonomic ID (NCBI) | 170187 |
| Genome Information |
| Gene Bank | AE005672 |
| EMBL | AE005672 |
| Gene Information |
| Gene Name | gtfA |
| NCBI Reference Sequence | NZ_AKVY01000001.1. |
| Protein information |
| Protein Name | GtfA |
| UniProtKB/ SwissProt ID | A0A0H2URG7 |
| NCBI Ref Seq | WP_000158459.1 |
| UniProtKB Sequence | >tr|A0A0H2URG7|A0A0H2URG7_STRPN Glycosyltransferase Gtf1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gtf1 PE=1 SV=1
MTIYNINLGIGWASSGVEYAQAYRAGVFRKLNLSSKFIFTDMILADNIQHLTANIGFDDN
QVIWLYNHFTDIKIAPTSVTVDDVLAYFGGEESHREKNGKVLRVFFFDQDKFVTCYLVDE
NKDLVQHAEYVFKGNLIRKDYFSYTRYCSEYFAPKDNVAVLYQRTFYNEDGTPVYDILMN
QGKEEVYHFKDKIFYGKQAFVRAFMKSLNLNKSDLVILDRETGIGQVVFEEAQTAHLAVV
VHAEHYSENATNEDYILWNNYYDYQFTNADKVDFFIVSTDRQNEVLQEQFAKYTQHQPKI
VTIPVGSIDSLTDSSQGRKPFSLITASRLAKEKHIDWLVKAVIEAHKELPELTFDIYGSG
GEDSLLREIIANHQAEDYIQLKGHAELSQIYSQYEVYLTASTSEGFGLTLMEAIGSGLPL
IGFDVPYGNQTFIEDGQNGYLIPSSSDHVEDQIKQAYAAKICQLYQENRLEAMRAYSYQI
AEGFLTKEILEKWKKTVEEVLHD
|
| EMBL CDS | AAK75833.1 |
| Sequence length | 503 AA |
| Subcellular Location | Membrane (Integral component of membrane) |
| Potential Application | 1) Structural information of glycosyltransferase may help in rational designing of inhibitors to combat infectious diseases.
2) Development of antibodies against PsrP which could be used as a preventive measure against pneumococcal infections. |
| PDB ID | 4PQG |
| Glycosyltransferase Information |
| Glycosylation Type | O- (Ser/Thr) linked |
| CAZY Family | GT4 |
| EC Number (BRENDA) | 2.4.1.- |
| Mechanism of Glycan Transfer | Sequential |
| Donor Type | Nucleotide activated sugars |
| Donor Specificity | UDP-GlcNAc |
| Accessory GT ID | ProGT75.1 ProGT75.2 ProGT75.3 ProGT75.4 ProGT75.5 ProGT75.6 ProGT75.7 |
| Glycan Information |
| Glycan transferred | Monosaccharide (GlcNAc) |
| Method of Glycan Indentification | LTQ Orbitrap MS |
| Experimental_strategies | In vivo and In vitro |
| Acceptor Subtrate Information |
| Acceptor Substrate name | PsrP (pneumococcal serine-rich repeat protein) |
| ProGPdb ID | ProGP449 |
| Litrature |
| Year Of Validation | 2014 |
| Reference | Shi, W.W., Jiang, Y.L., Zhu, F., Yang, Y.H., Shao, Q.Y., Yang, H.B., Ren, Y.M., Wu, H., Chen, Y. & Zhou, C. Z. (2014). Structure of a novel O-GlcNAc transferase GtfA reveals insights into the glycosylation of pneumococcal serine-rich repeat adhesins. Journal of Biological Chemistry, jbc-M114.
|
| Authors | Shi, W.W., Jiang, Y.L., Zhu, F., Yang, Y.H., Shao, Q.Y., Yang, H.B., Ren, Y.M., Wu, H., Chen, Y. & Zhou, C. Z.
|
| Research groups | Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230026, China
|
| Corresponding Author | Zhou, C. Z.
|
| Contacts | Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230026, China.
|
| Reference | Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z. (2017). Defining the enzymatic pathway for polymorphic O-glycosylation of the pneumococcal serine-rich repeat protein PsrP. The Journal of Biological Chemistry, 292, 6213-6224.
|
| Authors | Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z.
|
| Research groups | 1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China and.
2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China.
3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.
4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.
|
| Corresponding Author | Zhou, C. Z.
|
| Contacts | 1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China and.
2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China.
3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.
4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.
|
