Latest update: September 24, 2018


ProGT119 (Maf)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT119 (Maf)
Organism Information
Organism NameMagnetospirillum magneticum AMB-1
Clinical ImplicationNon-pathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Rhodospirillaceae
Order: Rhodospirillales
Class: Alphaproteobacteria
Phylum:Proteobacteria
Taxonomic ID (NCBI)342108
Genome Information
Gene BankAP007255
EMBLAP007255
Gene Information
Gene Nameamb0685
Protein information
Protein NameMaf 
UniProtKB/ SwissProt IDQ2W9I6
NCBI Ref SeqWP_011383128.1
UniProtKB Sequence>tr|Q2W9I6|Q2W9I6_MAGSA Uncharacterized protein OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=amb0685 PE=1 SV=1 MAAAPQINAELVSAYLEAFLELMPEMGERLRVHRPQSNLVVNEDGDLDVEFRGEFLYGPG GRKRIEDMATRTALGPDHRISAAPLSSGHVDLIVKRFLYNILKRATDSGLSFLQHPEESG GFHMVCLGLGLGYQLPILLEQDNPAGIHIVEPNFDFLYHSLSTVDWRPLLETRRENPLRL NIIIEEEPGQIARQLRSAIRCCCPIVVDWTRLFVAYNSPLLTAAMSEFMRDAQLIGIGLG FLHDEMEMTRASYKNMRDGRYSILQHSATQLHTPVFIVGSGPSIDDDIEVIKANQDRAVI ISCGTASRVLLANGIQPDFQMLLENGAAPYRALAAVHEEFGFGSATLIGSNTVDPRVRDL FEDVVYYFRPALSSYALFSPGIEYSLDDSGPTVTNTGTTAALALGFRELYLFGVDLGSRN PKRHHSKQSLYRHADDTKDGQKGAMDFDAVFDVREPGNFGGVVYSETIMLWTRDALGRII GRYRPAANAFNCSDGVMIENTRPLSSQSLRLKSTPDMKAKDLAKVRASFRPGGEELFHDR WDREDWPRSIVTLLGECAQAMDDHVGDSNRLMLVLSEMLLRDYKQPPTVAQFFVRGTLMM AAMCYDYYVKRVTPADRKAEFWEIIRDEFHQMIRVMTLQVEWYFDNIEAFESDEELFDKV TGWDYD
EMBL CDSBAE49489.1
Sequence length666 AA
Function in Native Organism 1) Maf is involved in bacterial flagella glycosylation.
String342108.amb0685
Potential Application1) 3D structure of Maf provides a structural template for the Maf family glycosyltransferases.
2) Structural studies may help the development of novel antibiotic agents specifically targeting these family pathogens.
Additional Information1) Maf dependent glycosylation of flagellin with pseudaminic acid is important for the assembly and export of flagellum monomers.
PDB ID 5MU5
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Glycan Information
Glycan transferredA nonulosonic acids sugar (most likely pseudaminic acid) 
Method of Glycan IndentificationLC-MS/MS
Experimental_strategiesIn vivo  
Acceptor Subtrate Information
Acceptor Substrate name Flagella
ProGPdb ID ProGP682
Litrature
Year Of Validation2018 
Reference Sulzenbacher, G., Roig-Zamboni, V., Lebrun, R., Guérardel, Y., Murat, D., Mansuelle, P., Yamakawa, N., Qian, X.X., Vincentelli, R., Bourne, Y. . & Wu, L. F. (2018). Glycosylate and move! The glycosyltransferase Maf is involved in bacterial flagella formation. Environmental microbiology, 20(1), 228-240.

Authors Sulzenbacher, G., Roig-Zamboni, V., Lebrun, R., Guérardel, Y., Murat, D., Mansuelle, P., Yamakawa, N., Qian, X.X., Vincentelli, R., Bourne, Y. . & Wu, L. F.
Research groups1 Aix Marseille Univ, CNRS, AFMB UMR7257, Marseille 13288, France. 2 Proteomic Platform, Institute of Microbiology of the Mediterranean, FR3479 Aix-Marseille University and National Center for Scientific Research, Marseille 13402, France. 3 Unit of Structural and Functional Glycobiology, UMR 8576 University of Lille and National Center for Scientific Research, Lille 59000, France. 4 Aix Marseille Univ, CNRS, LCB UMR7283, Marseille 13402, France. 5 International Associated Laboratory of Evolution and Development of Magnetotactic Organisms (LIA-MagMC), Centre National de la Recherche Scientifique, Marseille 13402, France.
Corresponding Author Wu, L. F.
Contacts International Associated Laboratory of Evolution and Development of Magnetotactic Organisms (LIA-MagMC), Centre National de la Recherche Scientifique, Marseille 13402, France.