ProGP1052 (Glutaredoxin)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP1052 (Glutaredoxin) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Ehrlichia ruminantium |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Alphaproteobacteria Orders : Rickettsiales Family : Anaplasmataceae Genus : Ehrlichia Species : ruminantium Strain : Gardel |
| Taxonomic ID (NCBI) | 302409 |
| Genome Information | |
| Organism Additional Information | Ehrlichia ruminantium is an obligate intracellular bacterium that causes heartwater, a fatal tick-borne disease of livestock |
| Gene Information | |
| Gene Name | grx |
| NCBI Gene ID | NC_006831.1 |
| Protein Information | |
| Protein Name | Glutaredoxin |
| UniProtKB/SwissProt ID | Q5FGI2 |
| UniProtKB Sequence | >tr|Q5FGI2|Q5FGI2_EHRRG Glutaredoxin OS=Ehrlichia ruminantium (strain Gardel) OX=302409 GN=grx MTFIKFLYLLSSITMISTNTWLNIIGYAVTKVIIYTKDFCSYCTKAKALFNRKNIPFEEINITGNSTLKDEMIQKSNGMKTLPQIFINDVHIGGCDDLYRLYESGQLKL |
| Subcellular Location | Cytosol/membrane |
| Function | Cell redox homeostasis |
| Glycosylation Status | |
| Technique(s) used for Glycosylation Detection | nLC–MS/MS Analysis |
| Literature | |
| Year of Identification | 2019 |
| Reference | Marcelino, I., Colomé-Calls, N., Holzmuller, P., Lisacek, F., Reynaud, Y., Canals, F. and Vachiéry, N., 2019. Sweet and sour ehrlichia: Glycoproteomics and phosphoproteomics reveal new players in Ehrlichia ruminantium physiology and pathogenesis. Frontiers in microbiology, 10, p.450. |
| Corresponding Author | Isabel Marcelino |
| Contact | 1. CIRAD, UMR ASTRE, Petit-Bourg, France. 2. ASTRE, CIRAD, INRA, Université de Montpellier, Montpellier, France. 3. Unitè TReD-Path (Transmission Rèservoirs et Diversitè des Pathogènes), Institut Pasteur de Guadeloupe, Les Abymes, France. |
