ProGP1177 (EsxC)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP1177 (EsxC) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Mycobacterium tuberculosis |
Domain | Bacteria |
Classification | Phylum : Actinobacteria Class : Actinomycetia Orders : Corynebacteriales Family : Mycobacteriaceae Genus : Mycobacterium Species : tuberculosis Strain : H37Rv |
Taxonomic ID (NCBI) | 83332 |
Genome Information | |
GenBank | NC_000962.3 |
Organism Additional Information | It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens. |
Gene Information | |
Gene Name | Rv3890c |
Protein Information | |
Protein Name | EsxC |
UniProtKB/SwissProt ID | P9WNI1 |
NCBI RefSeq | NP_218407.1 |
UniProtKB Sequence | >NP_218407.1 ESAT-6 like protein EsxC [Mycobacterium tuberculosis H37Rv] MSDQITYNPGAVSDFASDVGSRAGQLHMIYEDTASKTNALQEFFAGHGAQGFFDAQAQMLSGLQGLIETVGQHGTTTGHVLDNAIGTDQAIAGLF |
Function | Cell wall and cell processes |
Glycosylation Status | |
Glycosylation Type | O- (Ser) linked |
Experimentally Predicted Glycosites | S35 |
Experimentally Validated Glycosite(s) in Full Length Protein | S35 |
Experimentally Validated Glycosite(s ) in Mature Protein | >NP_218407.1 ESAT-6 like protein EsxC [Mycobacterium tuberculosis H37Rv] MSDQITYNPGAVSDFASDVGSRAGQLHMIYEDTAS*(35)KTNALQEFFAGHGAQGFFDAQAQMLSGLQGLIETVGQHGTTTGHVLDNAIGTDQAIAGLF |
Glycosite(s) Annotated Protein Sequence | QLHMIYEDTASKTNALQEFFA |
Technique(s) used for Glycosylation Detection | LC-MS/MS analysis |
Glycan Information | |
Glycan Annotation | Mannose |
Technique(s) used for Glycan Identification | nano LC-MS/MS analysis |
Literature | |
Year of Identification | 2020 |
Reference | Tucci, P., Portela, M., Chetto, C.R., González-Sapienza, G. and Marín, M., 2020. Integrative proteomic and glycoproteomic profiling of Mycobacterium tuberculosis culture filtrate. PloS one, 15(3), p.e0221837. |
Corresponding Author | Paula Tucci |
Contact | Biochemistry Section, Faculty of Sciences, University of the Republic, Montevideo, Uruguay. |