ProGP1177 (EsxC)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP1177 (EsxC) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Mycobacterium tuberculosis |
| Domain | Bacteria |
| Classification | Phylum : Actinobacteria Class : Actinomycetia Orders : Corynebacteriales Family : Mycobacteriaceae Genus : Mycobacterium Species : tuberculosis Strain : H37Rv |
| Taxonomic ID (NCBI) | 83332 |
| Genome Information | |
| GenBank | NC_000962.3 |
| Organism Additional Information | It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens. |
| Gene Information | |
| Gene Name | Rv3890c |
| Protein Information | |
| Protein Name | EsxC |
| UniProtKB/SwissProt ID | P9WNI1 |
| NCBI RefSeq | NP_218407.1 |
| UniProtKB Sequence | >NP_218407.1 ESAT-6 like protein EsxC [Mycobacterium tuberculosis H37Rv] MSDQITYNPGAVSDFASDVGSRAGQLHMIYEDTASKTNALQEFFAGHGAQGFFDAQAQMLSGLQGLIETVGQHGTTTGHVLDNAIGTDQAIAGLF |
| Function | Cell wall and cell processes |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser) linked |
| Experimentally Predicted Glycosites | S35 |
| Experimentally Validated Glycosite(s) in Full Length Protein | S35 |
| Experimentally Validated Glycosite(s ) in Mature Protein | >NP_218407.1 ESAT-6 like protein EsxC [Mycobacterium tuberculosis H37Rv] MSDQITYNPGAVSDFASDVGSRAGQLHMIYEDTAS*(35)KTNALQEFFAGHGAQGFFDAQAQMLSGLQGLIETVGQHGTTTGHVLDNAIGTDQAIAGLF |
| Glycosite(s) Annotated Protein Sequence | QLHMIYEDTASKTNALQEFFA |
| Technique(s) used for Glycosylation Detection | LC-MS/MS analysis |
| Glycan Information | |
| Glycan Annotation | Mannose |
| Technique(s) used for Glycan Identification | nano LC-MS/MS analysis |
| Literature | |
| Year of Identification | 2020 |
| Reference | Tucci, P., Portela, M., Chetto, C.R., González-Sapienza, G. and Marín, M., 2020. Integrative proteomic and glycoproteomic profiling of Mycobacterium tuberculosis culture filtrate. PloS one, 15(3), p.e0221837. |
| Corresponding Author | Paula Tucci |
| Contact | Biochemistry Section, Faculty of Sciences, University of the Republic, Montevideo, Uruguay. |