ProGP1233 (SvC)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP1233 (SvC) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Streptomyces venezuelae strain 15439 |
| Domain | Bacteria |
| Classification | Phylum : Actinobacteria Class : Actinomycetia Orders : Streptomycetales Family : Streptomycetaceae Genus : Streptomyces Species : venezuelae Strain : 15439 |
| Taxonomic ID (NCBI) | 54571 |
| Genome Information | |
| GenBank | CP013129.1 |
| Gene Information | |
| Gene Name | SvC |
| Protein Information | |
| Protein Name | SvC |
| NCBI RefSeq | ALO08693.1 |
| UniProtKB Sequence | >ALO08693.1 hypothetical protein AQF52_3099 [Streptomyces venezuelae] MTGPSRPGKEKHMSLSTLREMNFTTMSDSETDAVSGGRLSKAQCAAIWANAQANMLGYGCGGSYTDYMGI YNRECR |
| Function | Show antimicrobial activity to the close species and found in different type of glycocin biosynthesis clusters from previous chareterized glycocin. First glycocin characterized have less than four cysteine in the core peptide. |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) and S- (Cys) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | C23 |
| Experimentally Validated Glycosite(s ) in Mature Protein | >ALO08693.1 hypothetical protein AQF52_3099 [Streptomyces venezuelae] RLSKAQCAAIWANAQANMLGYGC*(23)GGSYTDYMGIYNRECR |
| Glycosite(s) Annotated Protein Sequence | NAQANMLGYGCGGSYTDYMGI |
| Technique(s) used for Glycosylation Detection | LC–MS/MS and Western blotting |
| Glycan Information | |
| Glycan Annotation | N-Acetylglucosamine, N-Acetylgalactosamine and glucose |
| Technique(s) used for Glycan Identification | LC–MS/MS and Western blotting |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST ProGT ID | ProGT138 (SvGT) |
| Literature | |
| Year of Identification | 2021 |
| Reference | Sharma, Y., Ahlawat, S. and Rao, A., 2021. Biochemical characterization of an inverting S/O-HexNAc-transferase and evidence of S-linked glycosylation in Actinobacteria. Glycobiology. |
| Corresponding Author | Alka rao |
| Contact | 1.CSIR-Institute of Microbial Technology, Sector 39A, Chandigarh 160036, India 2.Academy of Scientific and Innovation Research (AcSIR), Sector 19, Kamla Nehru Nagar, Ghaziabad 201002, Uttar Pradesh, India |