ProGP196 (ComP)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP196 (ComP) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Acinetobacter baylyi |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Gammaproteobacteria Orders : Pseudomondales Family : Moraxellaceae Genus : Acinetobacter Species : baylyi |
| Taxonomic ID (NCBI) | 62977 |
| Genome Information | |
| GenBank | AF012550 |
| EMBL | AF012550 |
| Gene Information | |
| Gene Name | comP |
| Protein Information | |
| Protein Name | ComP |
| UniProtKB/SwissProt ID | O30583 |
| EMBL-CDS | AAC45886.1 |
| UniProtKB Sequence | >tr|O30583|O30583_9GAMM ComP OS=Acinetobacter sp. BD413 GN=comP PE=3 SV=1 MNAQKGFTLIELMIVIAIIGILAAIAIPAYTDYTVRARVSEGLTAASSMKTTVSENILNA GALVAGTPSTAGSSCVGVQEISASNATTNVATATCGASSAGQIIVTMDTTKAKGANITLT PTYASGAVTWKCTTTSDKKYVPSECRG |
| Sequence length | 147 AA |
| Subcellular Location | Membrane associated |
| Function | This factor is essential for natural transformation of the gram-negative soil bacterium Acinetobacter sp. strain BD413 |
| Glycosylation Status | |
| Technique(s) used for Glycosylation Detection | Digoxigenin (DIG) labeling and detection, ZIC-HILIC for glycopeptide enrichment, multiple MS/MS fragmentation |
| Glycan Information | |
| Glycan Annotation | Pentasaccharide (HexNAc - HexNAc -HexNAc-HexNAc-HexNAc) |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PgILcomP |
| OST ProGT ID | ProGT84 |
| Literature | |
| Year of Identification | 2000 |
| Year of Identification Month Wise | 2000.07 |
| Reference | Harding, C.M., Nasr, M.A., Kinsella, R.L., Scott, N.E., Foster, L.J., Weber, B.S., Fiester, S.E., Actis, L.A., Tracy, E.N., Munson Jr, R.S. and Feldman, M.F., 2015. A cinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O‐glycosylation of multiple proteins. Molecular microbiology, 96(5), pp.1023-1041. |
| Corresponding Author | Mario F Feldman |
| Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. |
| Reference | Porstendörfer, D., Gohl, O., Mayer, F. and Averhoff, B., 2000. ComP, a pilin-like protein essential for natural competence in Acinetobacter sp. strain BD413: regulation, modification, and cellular localization. Journal of bacteriology, 182(13), pp.3673-3680. |
| Corresponding Author | Beate Averhoff |
| Contact | Institute of Microbiology and Genetics, Georg-August-University of Göttingen, D-37077 Göttingen, Germany. |
