ProGP214 (Flagellin B)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP214 (Flagellin B) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Helicobacter (Campylobacter) pylori 1061/J99 |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Epsilonproteobacteria Orders : Campylobacterales Family : Helicobacteraceae Genus : Helicobacter Species : pylori Strain : 1061/J99 |
| Taxonomic ID (NCBI) | 85963 |
| Genome Information | |
| GenBank | AE001439.1 |
| EMBL | AE001439 |
| Organism Additional Information | Helicobacter pylori is a Gram-negative, microaerophilic, human gastric pathogen classified by WHO as a Type 1 carcinogen. Its lipopolysaccharide (LPS) O-antigen is responsible for its virulence. Lewis antigens on its O-polysaccharides mimic glycan structures on human cells and interact with the C-type lectin DC-SIGN on dendritic cells, thereby down-regulating an inflammatory response. It also causes chronic type B gastritis (a prerequisite for duodenal ulcers) and is linked with mucosa-associated lymphoid tissue (MALT) and with B-cell MALT lymphomas. |
| Gene Information | |
| Gene Name | flaB ( jhp_0107) |
| NCBI Gene ID | 889505 |
| GenBank Gene Sequence | NC_000921.1 |
| Protein Information | |
| Protein Name | Flagellin B |
| UniProtKB/SwissProt ID | Q9ZMV8 |
| NCBI RefSeq | WP_000010021.1 |
| EMBL-CDS | AAD05686.1 |
| UniProtKB Sequence | >sp|Q9ZMV8|FLAB_HELPJ Flagellin B OS=Helicobacter pylori J99 GN=flaB PE=3 SV=3 MSFRINTNIAALTSHAVGVQNNRDLSSSLEKLSSGLRINKAADDSSGMAIADSLRSQSAN LGQAIRNANDAIGMVQTADKAMDEQIKILDTIKTKAVQAAQDGQTLESRRALQSDIQRLL EELDNIANTTSFNGQQMLSGSFSNKEFQIGAYSNTTVKASIGSTSSDKIGHVRMETSSFS GEGMLASAAAQNLTEVGLNFKQVNGVNDYKIETVRISTSAGTGIGALSEIINRFSNTLGV RASYNVMATGGTPVQSGTVRELTINGVEIGTVNDVHKNDADGRLTNAINSVKDRTGVEAS LDIQGRINLHSIDGRAISVHAASASGQVFGGGNFAGISGTQHAVIGRLTLTRTDARDIIV SGVNFSHVGFHSAQGVAEYTVNLRAVRGIFDANVASAAGANANGAQAETNSQGIGAGVTS LKGAMIVMDMADSARTQLDKIRSDMGSVQMELVTTINNISVTQVNVKAAESQIRDVDFAE ESANFSKYNILAQSGSFAMAQANAVQQNVLRLLQ |
| Sequence length | 514 AA |
| Subcellular Location | Secreted |
| Function | Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. Important for motility and virulence. |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | Immunoblotting using antiglycan antiserum. |
| Glycan Information | |
| Glycan Annotation | Pseudaminic acid (Pse5Ac7Ac, 5,7-diacetamido-3,5,7,9-tetradeoxy-L-glycero-L-manno-nonulosonic acid). O-linkage Ser/Thr at 10 sites. |
| BCSDB ID | 4618 |
| GlyTouCan | G75457NU |
| Literature | |
| Year of Identification | 2002 |
| Year of Identification Month Wise | 2002.5 |
| Reference | Schoenhofen, I.C., Lunin, V.V., Julien, J.P., Li, Y., Ajamian, E., Matte, A., Cygler, M., Brisson, J.R., Aubry, A., Logan, S.M. and Bhatia, S., 2006. Structural and functional characterization of PseC, an aminotransferase involved in the biosynthesis of pseudaminic acid, an essential flagellar modification in Helicobacter pylori. Journal of Biological Chemistry, 281(13), pp.8907-8916. |
| Corresponding Author | N. Martin Young |
| Contact | Institute for Biological Sciences, National Research Council, Ottawa, Ontario K1A 0R6. |
| Reference | Schirm, M., Soo, E.C., Aubry, A.J., Austin, J., Thibault, P. and Logan, S.M., 2003. Structural, genetic and functional characterization of the flagellin glycosylation process in Helicobacter pylori. Molecular microbiology, 48(6), pp.1579-1592. |
| Corresponding Author | Susan M Logan |
| Contact | Institute for Biological Sciences, National Research Council of Canada, Ottawa, Ontario K1A 0R6, Canada. |
| Reference | Josenhans, C., Vossebein, L., Friedrich, S. and Suerbaum, S., 2002. The neuA/flmD gene cluster of Helicobacter pylori is involved in flagellar biosynthesis and flagellin glycosylation. FEMS microbiology letters, 210(2), pp.165-172. |
| Corresponding Author | Christine Josenhans |
| Contact | Institute for Hygiene and Microbiology at the University of Würzburg, Josef-Schneider-Strasse 2, D-97080 Würzburg, Germany |
