ProGP216 (BclA (collagen-like protein))
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP216 (BclA (collagen-like protein)) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Bacillus anthracis str. Ames (Sterne 7702) |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Bacillales Family : Bacillaceae Genus : Bacillus Species : anthracis |
| Taxonomic ID (NCBI) | 1392 |
| Genome Information | |
| GenBank | AE016879.1 |
| EMBL | AE016879 |
| Organism Additional Information | Bacillus anthracis is a Gram-positive bacterium that forms spores, the causal agent of anthrax. This lethal infection involves both toxaemia and septicaemia. |
| Gene Information | |
| Gene Name | bclA (BA_1222) |
| NCBI Gene ID | 1084744 |
| GenBank Gene Sequence | NC_003997.3 |
| Protein Information | |
| Protein Name | BclA (collagen-like protein) |
| UniProtKB/SwissProt ID | Q81JD7 |
| NCBI RefSeq | WP_000069710.1 |
| EMBL-CDS | AAP25181.1 |
| UniProtKB Sequence | >tr|Q81JD7|Q81JD7_BACAN BclA protein OS=Bacillus anthracis GN=bclA PE=1 SV=1 MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGP TGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGD TGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGP TGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGP TGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETG FYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVI VTGLGLSLALGTSASIIIEKVA |
| Sequence length | 382 AA |
| Subcellular Location | Surface |
| Function | It is the major glycoprotein of exosporium and also the immunodominant protein of the spore surface. Exosporium is a loose fitting layer enclosing the spore. BclA forms the filaments of the external hair-like nap of the exosporium. |
| Protein Structure | |
| PDB ID | 2R6Q |
| Glycosylation Status | |
| Technique(s) used for Glycosylation Detection | ECL Glycoprotein detection kit and chemical deglycosylation using trifluoromethanesulfonic acid (TFMS). |
| Glycan Information | |
| Glycan Annotation | The protein is extensively O-glycosylated with a 715-Da Tetrasaccharide and a 324-Da disaccharide. The Tetrasaccharide contains three rhamnose residues and an unusual terminal sugar, 2-O-methyl-4- (3-hydroxy-3-methylbutanamido)-4,6-dideoxy-D-glucopyranose, named anthrose (Ant). The Tetrasaccharide has the structure:β-Ant-(1→3)-α-L-Rhap-(1→3)-α-L-Rhap-(1→2)-L-Rhap. Oligosaccharide is attached to the BclA through a GalNAc linker. In its absence, GlcNAc can serve as a substitute linker. |
| BCSDB ID | 23688 |
| GlyTouCan | G04931OZ |
| Protein Glycosylation linked (PGL) gene(s) | |
| Additional Comment | Owing to its absence in related strains of bacteria, anthrose has been regarded as a potential biomarker for anthrax detection. A hydrophilic collagen-like region (CLR) from 41?250 residue consists of 70 triplet repeats (GXX) including 54 GPT triplets. The CLR is the prominent feature of BclA. BclA has got a high glycine and proline content like that of mammalian collagen. |
| Literature | |
| Year of Identification | 2002 |
| Year of Identification Month Wise | 2002.7 |
| Reference | Oberli, M.A., Tamborrini, M., Tsai, Y.H., Werz, D.B., Horlacher, T., Adibekian, A., Gauss, D., Möller, H.M., Pluschke, G. and Seeberger, P.H., 2010. Molecular analysis of Carbohydrate− Antibody interactions: case study using a Bacillus anthracis Tetrasaccharide. Journal of the American Chemical Society, 132(30), pp.10239-10241. |
| Corresponding Author | Peter H. Seeberger |
| Contact | Department of Biomolecular Systems, Max-Planck Institute for Colloids and Interfaces, 14476 Potsdam, Germany. |
| Reference | Tamborrini, M., Holzer, M., Seeberger, P.H., Schürch, N. and Pluschke, G., 2010. Anthrax spore detection by a luminex assay based on monoclonal antibodies that recognize anthrose-containing oligosaccharides. Clinical and Vaccine Immunology, 17(9), pp.1446-1451. |
| Corresponding Author | Marco Tamborrini |
| Contact | Swiss Tropical and Public Health Institute, Socinstr. 57, CH 4002 Basel, Switzerland |
| Reference | Dong, S., Chesnokova, O.N., Turnbough Jr, C.L. and Pritchard, D.G., 2009. Identification of the UDP-N-acetylglucosamine 4-epimerase involved in exosporium protein glycosylation in Bacillus anthracis. Journal of bacteriology, 191(22), pp.7094-7101. |
| Corresponding Author | David G Pritchard |
| Contact | Department of Biochemistry and Molecular Genetics, University of Alabama at Birmingham, Birmingham, AL 35294-2170, USA. |
| Reference | Saksena, R., Adamo, R. and Kováč, P., 2006. Synthesis of the tetrasaccharide side chain of the major glycoprotein of the Bacillus anthracis exosporium. Bioorganic & medicinal chemistry letters, 16(3), pp.615-617. |
| Corresponding Author | Pavol Ková? |
| Contact | National Institute of Diabetes and Digestive and Kidney Disease/LMC, National Institutes of Health, Bethesda, MD 20892-0815, USA. |
