ProGP296 (FlaA (Flagellin))
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP296 (FlaA (Flagellin)) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Aeromonas caviae Sch3N strain |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Gammaproteobacteria Orders : Aeromonadales Family : Aeromonadaceae Genus : Aeromonas Species : punctata Strain : Sch3N strain |
| Taxonomic ID (NCBI) | 648 |
| Genome Information | |
| GenBank | AF198617 |
| EMBL | AF198617 |
| Gene Information | |
| Gene Name | flaA |
| Protein Information | |
| Protein Name | FlaA (Flagellin) |
| UniProtKB/SwissProt ID | Q9R9R9 |
| UniProtKB Sequence | >tr|Q9R9R9|Q9R9R9_AERCA Flagellin OS=Aeromonas caviae GN=flaA PE=3 SV=1 MSLYINTNVSSLNAQRNMMNSTKSLDTSYTRLASGLRINSAKDDAAGLQISNRLTSQING LDQGNRNANDGISLAQTAEGAMDEVTGMLQRMRTLAQQSANGSNSAKDREALQKEVDQLG AEINRISTATTFAGTKLLDGSFSGTFQVGADANQTIGFSLAQTGGFSISGIAKAAGTTID IVSGPAGSVTTATGISLIFTGGSAGGISISTQSKAQAVLAAADAMLEVVDSKRAELGAVQ NRLDSTIRNQANISENVSAARSRIRDADFATETANMTKQNILQQAASSILAQANQRPQSA LSLLQK |
| Function | Polar flagellin, Glycosylation helps in motility of the bacterium. |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | T155, S159, S161, S167, S169 |
| Technique(s) used for Glycosylation Detection | Collision-induced dissociation MS/MS (CID), Western Blotting |
| Technique(s) used for Glycosylated Residue(s) Detection | Collision-induced dissociation MS/MS (CID), Western Blotting |
| Glycan Information | |
| Glycan Annotation | Six to eight Pse5Ac7Ac (pseudaminic acid) residues found in S/T-rich domain spanning residues 159 to 232. |
| Literature | |
| Year of Identification | 2009 |
| Year of Identification Month Wise | 2009.2.13 |
| Reference | Tabei, S.M.B., Hitchen, P.G., Day-Williams, M.J., Merino, S., Vart, R., Pang, P.C., Horsburgh, G.J., Viches, S., Wilhelms, M., Tomás, J.M. and Dell, A., 2009. An Aeromonas caviae genomic island is required for both O-antigen lipopolysaccharide biosynthesis and flagellin glycosylation. Journal of bacteriology, 191(8), pp.2851-2863. |
| Corresponding Author | Jonathan G Shaw |
| Contact | Unit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom. |
| Reference | Lowry, R.C., Allihaybi, L., Parker, J.L., Couto, N.A., Stafford, G.P. and Shaw, J.G., 2022. Heterogeneous glycosylation and methylation of the Aeromonas caviae flagellin. MicrobiologyOpen, 11(4), p.e1306. |
| Corresponding Author | Jonathan G. Shaw Graham P. Stafford |
| Contact | Department of Infection Immunity and Cardiovascular Disease, University of Sheffield Medical School, Sheffield, UK School of Clinical Dentistry, Claremont Crescent, University of Sheffield, Sheffield, UK |