ProGPdb
Search
Example Display Page
ProGTdb
Search
Example Display Page
Structure Gallery
Crystal Structure
ProGP
ProGT
ProGT Accessory
AlphaFold2 Models
ProGT
ProGP
Tools
MapSequon
GlySeq Extractor
Predict Glycosite
Compare
BLAST
Access to beta launch of GlycoPP V2.0
Links
Related Reviews
Related Tools & Databases
Bibliography ProGlycProt
Patent
Update: ProGlycProt V3.0, 2023: New entries 668, total entries in the database 1655
| Access to beta launch of GlycoPP V2.0
ProGP33 (Streptococcal acid glycoprotein SAGP)
Home
-> ProGPdb ->
Search ProGP
-> Display data
Compare ID
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP1 (Envelope specific glycoprotein)
ProGP10 (Flagellin)
ProGP100 (PF sheath protein (44 kDa))
ProGP1000 (Uncharacterized protein)
ProGP1001 (VirB2 protein (homolog VirB2-8))
ProGP1002 (Uncharacterized protein)
ProGP1003 (Map1-related protein)
ProGP1004 (Map1-related protein)
ProGP1005 (Uncharacterized protein)
ProGP1006 (Enoyl-[acyl-carrier-protein] reductase [NADH])
ProGP1007 (Glyceraldehyde 3-phosphate dehydrogenase)
ProGP1008 (Chaperone protein hscA homolog)
ProGP1009 (Nucleoside diphosphate kinase)
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP1010 (Nitrogen assimilation regulatory protein NtrX)
ProGP1011 (Pyruvate dehydrogenase E1 component subunit alpha)
ProGP1012 (DNA polymerase I)
ProGP1013 (Phosphatidylserine decarboxylase proenzyme)
ProGP1014 (Probable ribonuclease D)
ProGP1015 (Putative Protease IV)
ProGP1016 (Phosphomethylpyrimidine synthase)
ProGP1017 (4-hydroxybenzoate octaprenyltransferase)
ProGP1018 (VIRB4 protein)
ProGP1019 (VirB8 protein)
ProGP102 (Flagellin B1)
ProGP1020 (Arginine--tRNA ligase)
ProGP1021 (Bacterioferritin comigratory protein)
ProGP1022 (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase)
ProGP1023 (Chaperone protein ClpB)
ProGP1024 (ATP-dependent Clp protease ATP-binding subunit ClpX)
ProGP1025 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
ProGP1026 (Enhancing lycopene biosynthesis protein 2)
ProGP1027 (Uncharacterized protein)
ProGP1028 (Uncharacterized protein)
ProGP1029 (Uncharacterized protein)
ProGP103 (Flagellin B2)
ProGP1030 (Uncharacterized protein)
ProGP1031 (Uncharacterized protein)
ProGP1032 (Uncharacterized protein)
ProGP1033 (Putative glutathione S-transferase)
ProGP1034 (Uncharacterized protein)
ProGP1035 (Uncharacterized protein)
ProGP1036 (Putative O-methyltransferase)
ProGP1037 (Probable transcriptional regulatory protein ERGA_CDS_03720)
ProGP1038 (Uncharacterized protein)
ProGP1039 (Uncharacterized protein)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP1040 (Uncharacterized protein)
ProGP1041 (Uncharacterized protein)
ProGP1042 (Hypothetical tRNA/rRNA methyltransferase)
ProGP1043 (Uncharacterized protein)
ProGP1044 (Uncharacterized protein)
ProGP1045 (Putative NADH-ubiquinone oxidoreductase subunit)
ProGP1046 (Map1-related protein)
ProGP1047 (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase)
ProGP1048 (Dihydropteroate synthase)
ProGP1049 (Possible major ferric iron binding protein)
ProGP105 (S-layer glycoprotein)
ProGP1050 (Glutamine synthetase I)
ProGP1051 (60 kDa chaperonin)
ProGP1052 (Glutaredoxin)
ProGP1053 (Ferrochelatase)
ProGP1054 (Integration host factor subunit alpha)
ProGP1055 (Possible geranyltranstransferase)
ProGP1056 (Maf-like protein EHRUM2_05950)
ProGP1057 (Malate dehydrogenase)
ProGP1058 (Quinolinate synthase A)
ProGP1059 (Nicotinate-nucleotide pyrophosphorylase)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP1060 (Multifunctional fusion protein)
ProGP1061 (NADH dehydrogenase I chain L)
ProGP1062 (Transcription termination/antitermination protein)
ProGP1063 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase)
ProGP1064 (Inorganic pyrophosphatase)
ProGP1065 (Peptide chain release factor 2)
ProGP1066 (Proline/betaine transporter)
ProGP1067 (Adenylosuccinate lyase)
ProGP1068 (Amidophosphoribosyltransferase)
ProGP1069 (Protein RecA)
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP1070 (3,4-dihydroxy-2-butanone 4-phosphate synthase)
ProGP1071 (50S ribosomal protein L13)
ProGP1072 (50S ribosomal protein L16)
ProGP1073 (DNA-directed RNA polymerase subunit alpha)
ProGP1074 (30S ribosomal protein S9)
ProGP1075 (30S ribosomal protein S19)
ProGP1076 (Protein-export protein SecB)
ProGP1077 (Protein-export membrane protein SecF)
ProGP1078 (Protein-export membrane protein SecF)
ProGP1079 (2-oxoglutarate dehydrogenase E1 component)
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP1080 (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex)
ProGP1081 (Succinyl-CoA synthetase subunit beta)
ProGP1082 (Succinyl-CoA ligase [ADP-forming] subunit alpha)
ProGP1083 (Ferredoxin--NADP reductase)
ProGP1084 (Putative Cold shock-like protein cspA)
ProGP1085 (Penicillin-binding protein dacF)
ProGP1086 (4-hydroxy-tetrahydrodipicolinate synthase)
ProGP1087 (Putative thiol:disulfide interchange protein dsbD)
ProGP1088 (Uncharacterized protein)
ProGP1089 (Uncharacterized protein)
ProGP109 (Stable protease)
ProGP1090 (Uncharacterized protein)
ProGP1091 (Uncharacterized protein)
ProGP1092 (Uncharacterized protein)
ProGP1093 (Uncharacterized protein)
ProGP1094 (Uncharacterized protein)
ProGP1095 (Uncharacterized protein)
ProGP1096 (Uncharacterized protein)
ProGP1097 (Uncharacterized protein)
ProGP1098 (Uncharacterized protein)
ProGP1099 (Uncharacterized protein)
ProGP11 (Autolysin (28 kDa))
ProGP110 (45 to 47-kDa protein)
ProGP1100 (Map1-related protein)
ProGP1101 (Uncharacterized protein)
ProGP1102 (Malonyl CoA-acyl carrier protein transacylase)
ProGP1103 (Dihydropteroate synthase)
ProGP1104 (Cell division protein FtsQ)
ProGP1105 (Citrate synthase)
ProGP1106 (Isocitrate dehydrogenase [NADP])
ProGP1107 (Outer membrane protein assembly factor BamA)
ProGP1108 (Peptidylprolyl isomerase)
ProGP1109 (Phosphate import ATP-binding protein PstB)
ProGP111 (S-layer glycoprotein)
ProGP1110 (N5-carboxyaminoimidazole ribonucleotide synthase)
ProGP1111 (Bifunctional protein PutA)
ProGP1112 (Ribose-5-phosphate isomerase)
ProGP1113 (50S ribosomal protein L19)
ProGP1114 (50S ribosomal protein L21)
ProGP1115 (50S ribosomal protein L22)
ProGP1116 (50S ribosomal protein L29)
ProGP1117 (RNA polymerase sigma factor RpoD)
ProGP1118 (Elongation factor Tu)
ProGP1119 (VirB11 protein)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP1120 (SCO3353)
ProGP1121 (SCO4307)
ProGP1122 (SCO2838)
ProGP1123 (SCO3046)
ProGP1124 (SCO4142)
ProGP1125 (SCO6558)
ProGP1126 (SCO3540)
ProGP1127 (SCO4141)
ProGP1128 (SCO5115)
ProGP1129 (SCO3357)
ProGP113 (Flagellin Laf1)
ProGP1130 (SCO4142)
ProGP1131 (SCO4968)
ProGP1132 (SCO5751)
ProGP1133 (SCO4256)
ProGP1134 (SCO5818)
ProGP1135 (SCO5776)
ProGP1136 (SCO0472)
ProGP1137 (SCO0996)
ProGP1138 (SCO1714)
ProGP1139 (SCO2035)
ProGP114 (Endo-β-N-acetylglucosaminidase F2)
ProGP1140 (SCO2096)
ProGP1141 (SCO2156)
ProGP1142 (SCO2963)
ProGP1143 (SCO3044)
ProGP1144 (SCO3046)
ProGP1145 (SCO3184)
ProGP1146 (SCO3357)
ProGP1147 (SCO3540)
ProGP1148 (SCO4130)
ProGP1149 (SCO4548)
ProGP115 (Flavastacin (P40))
ProGP1150 (SCO4739)
ProGP1151 (SCO4847)
ProGP1152 (SCO4885)
ProGP1153 (SCO4905)
ProGP1154 (SCO4934)
ProGP1155 (SCO5204)
ProGP1156 (SCO5646)
ProGP1157 (SCO5736)
ProGP1158 (SCO7218)
ProGP1159 (DsbA1 Protein)
ProGP116 (Endo-β-N-acetylglucosaminidase F3)
ProGP1160 (BCAL2640)
ProGP1161 (WTA-wall teichoic acid)
ProGP1162 (LTA- lipoteichoic acid)
ProGP1163 (Mpsy_1486)
ProGP1164 (DegP)
ProGP1165 (LspA)
ProGP1166 (SigA)
ProGP1167 (PstS1)
ProGP1168 (LprA)
ProGP1169 (LprF)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP1170 (DsbF)
ProGP1171 (Apa)
ProGP1172 (Wag31)
ProGP1173 (LppO)
ProGP1174 (Rv2799)
ProGP1175 (Mpt83)
ProGP1176 (LpqH)
ProGP1177 (EsxC)
ProGP1178 (DnaK)
ProGP1179 (OtsB1)
ProGP118 (Flagellin)
ProGP1180 (RplV)
ProGP1181 (DeaD)
ProGP1182 (InfC)
ProGP1183 (Pks5)
ProGP1184 (FadD28)
ProGP1185 (FhaA)
ProGP1186 (Rv0348)
ProGP1187 (DosT)
ProGP1188 (DesvR)
ProGP1189 (Icd2)
ProGP119 (Fimbrial protein (pilin))
ProGP1190 (Rv0216)
ProGP1191 (ThiD)
ProGP1192 (PnP)
ProGP1193 (MenH)
ProGP1194 (PurN)
ProGP1195 (PhoH2)
ProGP1196 (GlpX)
ProGP1197 (HtrA)
ProGP1198 (CarB)
ProGP1199 (GlnA1)
ProGP12 (12 kDa antigen)
ProGP120 (Protein A (cell wall glycoprotein))
ProGP1200 (AceE)
ProGP1201 (AroA)
ProGP1202 (SahH)
ProGP1203 (Rv3273)
ProGP1204 (Rv0311)
ProGP1205 (Rv0566c)
ProGP1206 (Rv1352)
ProGP1207 (Rv1466)
ProGP1208 (Rv2166c)
ProGP1209 (Rv2558)
ProGP121 (Surface layer glycoprotein Sat B)
ProGP1210 (Rv2826c)
ProGP1211 (Rv3491)
ProGP1212 (BCAL0114 (FliC))
ProGP1213 (BCAL0129 (CheA))
ProGP1214 (BCAL0524 (FliG))
ProGP1215 (BCAL0525 (FliF))
ProGP1216 (HuvA)
ProGP1217 (AidA)
ProGP1218 (SLP-5818)
ProGP1219 (SLP-5818)
ProGP122 (Surface layer glycoprotein SatA)
ProGP1220 (SLP-8321)
ProGP1221 (SLP-8348)
ProGP1222 (BTL2)
ProGP1223 (FlaB1)
ProGP1224 (FlaB2)
ProGP1225 (FlaB3)
ProGP1226 (FlaB4)
ProGP1227 (Fla A)
ProGP1228 (Acm2)
ProGP1229 (GkFlaA1)
ProGP123 (CRX (Copper response extracellular protein))
ProGP1230 (GkFlaA2)
ProGP1231 (CbFla)
ProGP1232 (Flagella)
ProGP1233 (SvC)
ProGP1234 (Conserved hypothetical protein)
ProGP1235 (DUF192 family protein)
ProGP1236 (Thermosome subunit 3)
ProGP1237 (ABC-type transport system periplasmic substrate-binding protein (probable substrate))
ProGP1238 (Pilin PilA)
ProGP1239 (Cox-type terminal oxidase subunit II)
ProGP124 (β-1,4-mannanase)
ProGP1240 (DUF4382 domain protein)
ProGP1241 (Conserved hypothetical protein)
ProGP1242 (Archaellin A1)
ProGP1243 (Archaellin A2)
ProGP1244 (Conserved hypothetical protein)
ProGP1245 (Dolichyl-monophosphooligosaccharide— protein glycotransferase AglB)
ProGP1246 (Conserved hypothetical protein)
ProGP1247 (Conserved hypothetical protein)
ProGP1248 (Conserved hypothetical protein)
ProGP1249 (Peptidase M10 family protein)
ProGP125 (Flagellin)
ProGP1250 (Conserved hypothetical protein)
ProGP1251 (M50 family metalloprotease)
ProGP1252 (Probable transmembrane glycoprotein/HTH domain protein)
ProGP1253 (Conserved hypothetical protein)
ProGP1254 (Protein-export membrane protein SecD)
ProGP1255 (GATase domain protein)
ProGP1256 (Pilin PilA)
ProGP1257 (Conserved hypothetical protein)
ProGP1258 (Conserved hypothetical protein)
ProGP1259 (Probable secreted glycoprotein)
ProGP126 (31/33 kDa flagellin)
ProGP1260 (SLG)
ProGP1261 (Probable secreted glycoprotein)
ProGP1262 (Probable secreted glycoprotein (nonfunctional))
ProGP1263 (Pectin lyase domain protein)
ProGP1264 (Conserved hypothetical protein)
ProGP1265 (ABC-type transport system permease protein (probable substrate macrolides))
ProGP1266 (Probable secreted glycoprotein)
ProGP1267 (Probable secreted glycoprotein)
ProGP1268 (Conserved hypothetical protein)
ProGP1269 (Conserved hypothetical protein)
ProGP127 (Flagellin B1 (41 kDa))
ProGP1270 (DUF1616 family protein)
ProGP1271 (Conserved hypothetical protein)
ProGP1272 (Conserved hypothetical protein)
ProGP1273 (Conserved hypothetical protein)
ProGP1274 (Conserved hypothetical protein)
ProGP1275 (Conserved hypothetical protein)
ProGP1276 (Conserved hypothetical protein)
ProGP1277 (LppX domain protein)
ProGP1278 (Hypothetical protein)
ProGP1279 (Conserved hypothetical protein)
ProGP128 (wmA (S-layer protein))
ProGP1280 (Probable transmembrane glycoprotein/HTH domain protein)
ProGP1281 (DNA-directed RNA polymerase subunit A’)
ProGP1282 (Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3)
ProGP1283 (50S ribosomal protein L43e)
ProGP1284 (Aspartate–tRNA(Asp/Asn) ligase)
ProGP1285 (Glutamate synthase (ferredoxin) large subunit)
ProGP1286 (30S ribosomal protein S15)
ProGP1287 (UspA domain protein)
ProGP1288 (Conserved hypothetical protein)
ProGP1289 (Probable phosphoribosyltransferase (homolog to anthranilate phosphoribosyltransferase))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP1290 (Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3)
ProGP1291 (Aspartate-semialdehyde dehydrogenase)
ProGP1292 (L-aspartate oxidase)
ProGP1293 (ABC-type transport system periplasmic substrate-binding protein (probable substrate dipeptide/oligopeptide))
ProGP1294 (ATP-dependent cobaltochelatase subunit CobN)
ProGP1295 (Pyruvate Kinase)
ProGP1296 (3-mthyl-2-oxobutanoate hydroxymethyl-transferase)
ProGP1297 (Pilin PilA)
ProGP1298 (Flagella)
ProGP1299 (S-layer glycoprotein (SlpA))
ProGP13 (33 kDa antigen)
ProGP130 (Pyrolysin)
ProGP1300 (FljK, Flagellin protein)
ProGP1301 (FljK, Flagellin protein)
ProGP1302 (NagC)
ProGP1303 (GlmR)
ProGP1304 (Hypothetical protein, CHU_2708)
ProGP1305 (Cel9A)
ProGP1306 (Pilin protein)
ProGP1307 (PilA)
ProGP1308 (AlpA/B)
ProGP1309 (BabA/B)
ProGP131 (Cell surface phosphatase)
ProGP1310 (SLP, S-layer protein)
ProGP1311 (Thread (Fourth filament))
ProGP1312 (PilE)
ProGP1313 (PilE)
ProGP1314(S-layer Protein, SLG)
ProGP132 (Chondroitinase-AC)
ProGP133 (Heparinase II)
ProGP134 (Exopolymer)
ProGP135 (37-kDa protein)
ProGP136 (Antigen (60 kDa))
ProGP137 (Oscillin (65.8 kDa))
ProGP138 (Cell surface glycoprotein)
ProGP139 (S-layer glycoprotein)
ProGP14 (Membrane glycoprotein)
ProGP140 (α-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP142 (Antifreeze protein)
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP145 (Adhesion inhibitor)
ProGP146 (Flagellin)
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP148 (β-1,4-mannanase (G-enzyme))
ProGP149 (Crystal toxin (66 kDa))
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP152 (Type A Flagellin)
ProGP153 (Flagellin)
ProGP154 (Flagellin)
ProGP155 (Flagellin)
ProGP156 (AnAF)
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP158 (FlaB (flagellar core protein))
ProGP159 (FlaB (flagellar core protein))
ProGP16 (50 kDa antigen)
ProGP160 (Flagellar filament 31.3 kDa core protein)
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP164 (FlaB (flagellar core protein))
ProGP165 (S-layer glycopeptide)
ProGP166 (Chondroitinase-B)
ProGP167 (BclA (collagen-like protein))
ProGP168 (Slp (S-layer glycoprotein))
ProGP169 (Surface layer glycoproteins)
ProGP17 (Flagellin)
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP172 (S-layer glycoprotein)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP174 (Flagellin A)
ProGP175 (Flagellin B)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP177 (HRgpA)
ProGP178 (mtRgpA)
ProGP179 (S-layer glycoprotein)
ProGP18 (S-layer glycoprotein SgsE)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP185 (Invertase)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP187 (flaA)
ProGP188 (flaB)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP190 (LppN lipoprotein)
ProGP191 (LppQ lipoprotein)
ProGP192 (LpqH)
ProGP193 (PstS1)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP196 (ComP)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP198 (Flagellin)
ProGP199 (Flagellin)
ProGP2 (Phytotoxin)
ProGP20 (Outer membrane protein (50 kDa))
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP205 (Flagellin A (FlaA))
ProGP206 (Flagellin (FlaA))
ProGP207 (Glycopeptidolipid (GPL))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP21 (Outer membrane protein (75 kDa))
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP213 (95-kDa glycoprotein)
ProGP214 (Flagellin B)
ProGP215 (Flagellin A (FlaA))
ProGP216 (BclA (collagen-like protein))
ProGP217 (AcrA or CmeA)
ProGP218 (CgpA)
ProGP219 (Cj0114)
ProGP22 (Flagellin FlaB1)
ProGP220 (Cj0200c)
ProGP221 (Cj1496c)
ProGP222 (PEB3)
ProGP223 (ZnuA)
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP227 (HMW1 (Adhesin))
ProGP228 (Short glycopeptides)
ProGP229 (GspB)
ProGP23 (Flagellin FlaB2)
ProGP230 (PilA (Type IV pilin))
ProGP231 (VirB10 protein)
ProGP232 (Flagellin FlaA)
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP234 (CipA (conserved hypothetical protein))
ProGP235 (CipB (putative dipeptide-binding protein
ProGP236 (HisJ)
ProGP237 (SgtA)
ProGP238 (FlaB1)
ProGP239 (FlaB2)
ProGP24 (Flagellin FlaB3)
ProGP240 (FlaB3)
ProGP241 (FlaA)
ProGP242 (S-layer protein)
ProGP243 (Synthetic Glycopeptide)
ProGP244 (SrpA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP248 (Flagellin B)
ProGP249 (Ag43 α (Antigen 43 passenger domain))
ProGP25 (33 and 34 kDa antigens)
ProGP250 (PilA (Pilin))
ProGP251 (Type b Flagellin)
ProGP252 (DgpA)
ProGP253 (DgpC)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP255 (HmcA)
ProGP256 (CmeC)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP258 (FlaB3)
ProGP259 (FlaB1)
ProGP26 (CenA (Endoglucanase A))
ProGP260 (FlaB2)
ProGP261 (Flagellin (FlaA))
ProGP262 (Pillin (Group IV))
ProGP263 (Rv3491)
ProGP264 (Glycosyl hydrolase)
ProGP265 (Rv2799)
ProGP266 (LprA)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP270 (BlaC)
ProGP271 (FecB)
ProGP272 (LppL)
ProGP273 (LppX (Putative lipoprotein))
ProGP274 (LppZ (Putative lipoprotein))
ProGP275 (LpqB lipoprotein)
ProGP276 (LpqF lipoprotein)
ProGP277 (LpqI)
ProGP278 (LpqN)
ProGP279 (LpqT (putative lipoprotein))
ProGP28 (Flagellin A1)
ProGP280 (LpqW (lipoprotein))
ProGP281 (LprF)
ProGP282 (prG)
ProGP283 (OppA)
ProGP284 (PonA2)
ProGP285 (PpiB)
ProGP286 (PstS2)
ProGP287 (PstS3)
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP29 (Flagellin A2)
ProGP290 (Rv0907)
ProGP291 (Rv0988)
ProGP292 (Rv1084)
ProGP293 (Rv2813)
ProGP294 (Secreted protease)
ProGP295 (Thioredoxin)
ProGP296 (FlaA (Flagellin))
ProGP297 (FlaB (Flagellin))
ProGP298 (FliC (Flagellin subunit))
ProGP299 (CcoP)
ProGP3 (S-layer glycoprotein)
ProGP30 (Flagellin B1)
ProGP300 (CycB)
ProGP301 (S-layer Protein)
ProGP302 (AniA)
ProGP303 (DsbA)
ProGP304 (Gna1946)
ProGP305 (Laz)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP307 (PotF)
ProGP308 (Sco)
ProGP309 (PstS (40 kDa))
ProGP31 (Flagellin B2)
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP313 (Hypothetical protein)
ProGP314 (Putative exported protein)
ProGP315 (Putative outer membrane protein)
ProGP316 (Srr1)
ProGP317 (BF3567)
ProGP318 (BF3918)
ProGP319 (BF0935)
ProGP32 (Flagellin B3)
ProGP320 (LppC)
ProGP321 (OmpA)
ProGP322 (EtpA Adhesin)
ProGP323 (JlpA (42-45 kDa antigen))
ProGP324 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP326 (FliC (Flagellin))
ProGP327 (LccA, an Archaeal Laccase)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP329 (FTH_1830)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP330 (FTH_0159)
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP334 (FTH_0311)
ProGP335 (FTH_1167)
ProGP336 (FTH_1761)
ProGP337 (FTH_1721)
ProGP338 (FTH_1293)
ProGP339 (FTH_0069)
ProGP34 (S-layer glycoprotein)
ProGP340 (FTH_1071)
ProGP341 (FTH_0414)
ProGP342 (FTH_0357)
ProGP343 (PilA (FTH_0384))
ProGP344 (SlaA (S-layer protein))
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP346 (Chondroitinase ABC)
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP348 (TfsB (S-layer protein))
ProGP349 (TF1259)
ProGP35 (β-1,4-Endoglucanases)
ProGP350 (TF2339)
ProGP351 (BF0810)
ProGP352 (Putative cell division protein)
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP357 (Putative lipoprotein)
ProGP358 (Putative membrane protein)
ProGP359 (Putative membrane protein)
ProGP36 (S-layer glycoprotein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP362 (Putative sulfatase family protein)
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP364 (Putative integral membrane protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP367 (Putative uncharacterized protein)
ProGP368 (Colicin V production protein)
ProGP369 (Putative membrane protein)
ProGP37 (S-layer glycoprotein)
ProGP370 (Putative exporting protein)
ProGP371 (Putative secreted protease)
ProGP372 (Putative periplasmic protein)
ProGP373 (Putative periplasmic protein)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP377 (Putative periplasmic protein)
ProGP378 (Putative membrane protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP38 (VGP (74 kDa))
ProGP380 (Putative periplasmic protein)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP382 (Putative secreted transglycosylase)
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP389 (Putative integral membrane protein)
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP390 (Putative sulfatase protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP392 (Putative periplasmic protein)
ProGP393 (Putative integral membrane protein)
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP399 (TfsA (S-layer protein))
ProGP4 (F-pilin)
ProGP40 (Long-fibril protein (LFP))
ProGP400 (Sublancin)
ProGP401 (Plantaricin ASM1)
ProGP402 (Glycocin F)
ProGP403 (FlaA (Flagellin))
ProGP404 (FlaB (Flagellin))
ProGP405 (TF0091)
ProGP406 (TF1056)
ProGP407 (EhaJ (autotranporter))
ProGP408 (FliC (Flagellin))
ProGP409 (FliC (Flagellin))
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP410 (DsbA)
ProGP411 (FTL_1096)
ProGP412 (OmpA/MotB)
ProGP413 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP416 (Putative Uncharacterized Protein)
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP42 (Cellobiosidase)
ProGP420 (FlaA (Polar flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP422 (LafA (Lateral flagellin))
ProGP423 (AniA)
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP425 (ABC Transporter (TreS))
ProGP426 (Oligopeptide binding protein)
ProGP427 (Hypothetical protein)
ProGP428 (Protease)
ProGP429 (Maltose ABC transporter)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP430 (Serine protease)
ProGP431 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP433 (Hypothetical protein)
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP435 (FasC (fasciclin domain protein))
ProGP436 (Acm2)
ProGP437 (FliC (Type B Flagellin))
ProGP438 (DnaK)
ProGP439 (Lp_2260)
ProGP44 (S-layer glycoprotein)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP442 (PdhC)
ProGP443 (FtsY)
ProGP444 (Lp_ 2793)
ProGP445 (FtsK1)
ProGP446 (Lp_3421)
ProGP447 (FtsZ)
ProGP448 (MOMP)
ProGP449 (PsrP (Adhesin))
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP450 (AtaC)
ProGP451 (COK_1394)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP454 (Rv1887)
ProGP455 (35kDa protein)
ProGP456 (Rv3835)
ProGP457 (LppO (Putative lipoprotein))
ProGP458 (ThuA)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP463 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP466 (Putative protein)
ProGP467 (Alanine and proline-rich secreted protein)
ProGP468 (C-terminal protease)
ProGP469 (MdtA multidrug resistance protein)
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP470 (Putative uncharacterized protein)
ProGP471 (Putative uncharacterized protein)
ProGP472 (Putative signal peptide)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP475 (Putative uncharacterized protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP477 (Putative cell division related protein)
ProGP478 (Putative uncharacterized protein)
ProGP479 (Putative lipoprotein)
ProGP48 (S-layer glycoprotein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP481 (CpxP-like protein)
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprotein)
ProGP484 (Putative exported protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP486 (Putative membrane protein)
ProGP487 (OM lipoprotein carrier LolA)
ProGP488 (OmlA)
ProGP489 (Cell division protein)
ProGP49 (S-layer glycoprotein)
ProGP490 (OmpA family protein)
ProGP491 (Putative uncharacterized protein)
ProGP492 (Type IV Pilin)
ProGP493 (CN)
ProGP494 (FliC (Flagellin))
ProGP495 (EF-P)
ProGP496 (PliA)
ProGP497 (Putative secretion protein)
ProGP498 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP5 (Factor PG-1)
ProGP50 (Flagellin A)
ProGP500 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP502 (Uncharacterized protein)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP506 (MetQ)
ProGP507 (Sco)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP509 (Ccop)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP510 (Translation elongation factor P (EF-P))
ProGP511 (Translation elongation factor P (EF-P))
ProGP512 (Enterocin F4-9)
ProGP513 (Knh)
ProGP514 (EmaA)
ProGP515 (NirK)
ProGP516 (C5)
ProGP517 (CcoP)
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP52 (Hypothetical protein)
ProGP520 (Hag flagellin)
ProGP521 (EF-P)
ProGP522 (Putative membrane fusion protein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP528 (FtsN)
ProGP529 (AcrA)
ProGP53 (33 kDa minor core flagellin)
ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrolase)
ProGP531 (Probable transmembrane protein)
ProGP532 (Probable serine protease protein)
ProGP533 (Probable m20-related peptidase)
ProGP534 (PilN)
ProGP535 (Probable lipoprotein)
ProGP536 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP538 (Probable transmembrane protein)
ProGP539 (PilA)
ProGP54 (34 kDa major core flagellin)
ProGP540 (Probable peptidase transmembrane protein)
ProGP541 (FtsL)
ProGP542 (Translation elongation factor P (EF-P))
ProGP543 (Flagellin A1)
ProGP544 (Flagellin A2)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP548 (Pilin A4)
ProGP549 (Pilin A6)
ProGP55 (Cell surface protein/S-layer protein)
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP553 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP555 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP557 (Hypothetical protein)
ProGP558 (ABC transporter substrate binding protei
ProGP559 (Pullulanase)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP560 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP562 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP564 (Hypothetical protein)
ProGP565 (Peptide binding protein)
ProGP566 (Multidrug RND transporter)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP57 (38 kDa antigen)
ProGP570 (Peptide transporter)
ProGP571 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP573 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP575 (Hypothetical protein)
ProGP576 (Penicillin amidase)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP578 (Cytochrome c biogenesis protein)
ProGP579 (Hypothetical protein)
ProGP58 (Thermopsin)
ProGP580 (Histidine kinase)
ProGP581 (Cytochrome c assembly)
ProGP582 (Metallophosphoesterase)
ProGP583 (ATP synthase subunit A)
ProGP584 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP586 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP59 (β-1, 4-D-glucosidase (51 kDa))
ProGP590 (Hypothetical protein)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP592 (Peptidase)
ProGP593 (Hypothetical protein)
ProGP594 (ABC transporter substrate binding protei
ProGP595 (Glycosyl transferase)
ProGP596 (Nitrate reductase beta subunit)
ProGP597 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP599 (Hypothetical protein)
ProGP6 (Cellulase CA)
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP600 (Hypothetical protein)
ProGP601 (Transglutaminase)
ProGP602 (FAD-dependent oxidoreductase)
ProGP603 (ABC transporter substrate binding protein)
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein)
ProGP606 (ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP609 (Hypothetical protein)
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP613 (Nitrous oxidase accessory protein)
ProGP614 (Glutamate dehydrogenase)
ProGP615 (Hypothetical protein)
ProGP616 (NADH dehydrogenase subunit D)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP618 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP62 (18 kDa and 32 kDa lectin binding proteins)
ProGP620 (Hypothetical protein)
ProGP621 (Sugar binding protein)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP623 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP625 (Hypothetical protein)
ProGP626 (Serpin)
ProGP627 (Hypothetical protein)
ProGP628 (ABC transporter substrate binding protein)
ProGP629 (ATPase)
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP630 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP634 (Peptide ABC transporter permease)
ProGP635 (TRAP ABC transporter)
ProGP636 (NosD)
ProGP637 (Cytochrome c biogenesis protein)
ProGP638 (Excisionase)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP640 (Primosomal protein)
ProGP641 (Hypothetical protein)
ProGP642 (Cytochrome c assembly protein)
ProGP643 (Glycosyltransferase)
ProGP644 (Hypothetical protein)
ProGP645 (ABC transporter substrate binding protein)
ProGP646 (Glycosyltransferase)
ProGP647 (Hypothetical protein)
ProGP648 (Nitrate reductase)
ProGP649 (Transcriptional regulator)
ProGP65 (24 kDa flagellin)
ProGP650 (Hypothetical protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP656 (RNA methyltransferase)
ProGP657 (Transcriptional regulator)
ProGP658 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP66 (25 kDa flagellin)
ProGP660 (Hypothetical protein)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP662 (30S ribosomal protein S2)
ProGP663 (Protein disulfide isomerase like protein)
ProGP664 (V-type ATPase subunit D)
ProGP665 (ABC transporter)
ProGP666 (ABC transporter)
ProGP667 (V-type ATP synthase subunit E)
ProGP668 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP67 (35 kDa flagellin)
ProGP670 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP672 (Hypothetical protein)
ProGP673 (FHA domain containing protein)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP678 (Hypothetical protein)
ProGP679 (Nitrate reductase alpha subunit)
ProGP68 (S-layer glycoprotein)
ProGP680 (Peptidase S8)
ProGP681 (Formate dehydrogenase)
ProGP682 (Flagellin)
ProGP683 (Flagellin)
ProGP684 (S-layer glycoprotein (pNG5138))
ProGP685 (Msp1)
ProGP686 (Ta0280)
ProGP687 (Ta1063)
ProGP688 (Ta1052)
ProGP689 (Ta0171)
ProGP69 (S-layer glycoprotein)
ProGP690 (Ta0261)
ProGP691 (Kustd1514)
ProGP692 (SpaCBA)
ProGP693 (Serine rich-repeat SrpA)
ProGP694 (Serine rich-repeat SrpB)
ProGP695 (Serine rich-repeat SrpC)
ProGP696 (WpaA)
ProGP697 (Cnm)
ProGP698 (HgpA)
ProGP699 (Cellulose A)
ProGP7 (Cellulase CB)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP700 (SlpA protein)
ProGP701 (hypothetical protein)
ProGP702 (hypothetical protein)
ProGP703 (Bacillicin CER074)
ProGP704 (Bacillicin BAG2O)
ProGP705 (Geocillicin)
ProGP706 (Listeriocytocin)
ProGP707 (CleA)
ProGP708 (WTA-wall teichoic acid)
ProGP709 (PalA)
ProGP71 (S-layer glycoprotein)
ProGP710 (Hyp1)
ProGP711 (Hyp2)
ProGP712 (Asm1)
ProGP713 (SRRP100-23)
ProGP714 (SRRP53608)
ProGP715 (LpqH)
ProGP716 (AcpM)
ProGP717 (Uncharacterized protein)
ProGP718 (Uncharacterized protein)
ProGP719 (Uncharacterized protein)
ProGP72 (Alkaline Phosphatase D)
ProGP720 (Aminotransferase)
ProGP721 (Aconitate hydratase)
ProGP722 (Acyl carrier protein)
ProGP723 (Adenylate kinase)
ProGP724 (Alanine--tRNA ligase)
ProGP725 (Alkaline protease secretion ATP-binding protein AprD)
ProGP726 (Alkaline protease secretion protein)
ProGP727 (N-acetyl-gamma-glutamyl-phosphate reductase)
ProGP728 (Ornithine carbamoyltransferase)
ProGP729 (Argininosuccinate synthase)
ProGP73 (p115/ PAAP)
ProGP730 (Argininosuccinate lyase)
ProGP731 (Arginine biosynthesis bifunctional protein ArgJ)
ProGP732 (Aspartate-semialdehyde dehydrogenase)
ProGP733 (Aspartate--tRNA(Asp/Asn) ligase)
ProGP734 (Putative ATP synthase epsilon chain 2)
ProGP735 (ATP synthase gamma chain)
ProGP736 (ATP synthase subunit delta)
ProGP737 (ATP synthase B chain)
ProGP738 (Carbamoyl-phosphate synthase small chain)
ProGP739 (Carbamoyl-phosphate synthase large chain)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP740 (ATP-dependent Clp protease proteolytic subunit)
ProGP741 (Cytochrome c oxidase subunit 2)
ProGP742 (Cytochrome c oxidase subunit 1)
ProGP743 (Cytochrome c homolog)
ProGP744 (Cysteine--tRNA ligase)
ProGP745 (4-hydroxy-tetrahydrodipicolinate reductase)
ProGP746 (Peptide deformylase)
ProGP747 (DNA/pantothenate metabolism flavoprotein homolog)
ProGP748 (Chaperone protein DnaJ)
ProGP749 (DNA polymerase III subunit beta)
ProGP75 (S-layer glycoprotein)
ProGP750 (DNA polymerase III subunit gamma/tau)
ProGP751 (Deoxyuridine 5'-triphosphate nucleotidohydrolase)
ProGP752 ((Dimethylallyl)adenosine tRNA methylthiotransferase)
ProGP753 (GTPase Der)
ProGP754 (Enolase)
ProGP755 (Hemolysin cluster)
ProGP756 (VirB8 protein)
ProGP757 (Uncharacterized protein)
ProGP758 (Uncharacterized protein)
ProGP759 (Uncharacterized protein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP760 (Uncharacterized protein)
ProGP761 (Uncharacterized protein)
ProGP762 (Uncharacterized protein)
ProGP763 (Uncharacterized protein)
ProGP764 (Uncharacterized protein)
ProGP765 (Uncharacterized protein)
ProGP766 (Uncharacterized protein)
ProGP767 (Uncharacterized protein)
ProGP768 (ABC transporter substrate binding protein)
ProGP769 (Uncharacterized protein)
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP770 (Uncharacterized protein)
ProGP771 (Uncharacterized protein)
ProGP772 (Uncharacterized protein)
ProGP773 (uncha/CBS/transporter associated domain protein)
ProGP774 (Histidine kinase PleC)
ProGP775 (Uncharacterized protein)
ProGP776 (Uncharacterized protein)
ProGP777 (Uncharacterized protein)
ProGP778 (Uncharacterized protein)
ProGP779 (Putative regulatory component of sensory transduction system PleD)
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP780 (Uncharacterized protein)
ProGP781 (Uncharacterized protein)
ProGP782 (Uncharacterized protein)
ProGP783 (Deoxyguanosinetriphosphate triphosphohydrolase-like protein)
ProGP784 (Probable sigma(54) modulation protein)
ProGP785 (Uncharacterized protein)
ProGP786 (Uncharacterized protein)
ProGP787 (Uncharacterized protein)
ProGP788 (Uncharacterized protein)
ProGP789 (Uncharacterized protein)
ProGP79 (S-layer glycoprotein)
ProGP790 (Uncharacterized protein)
ProGP791 (Probable aminoglycoside efflux pump (Acriflavine resistance protein D))
ProGP792 (Similar to human and bovine Cytochrome c1)
ProGP793 (Uncharacterized protein)
ProGP794 (Uncharacterized protein)
ProGP795 (VirB6 protein)
ProGP796 (VirB6 protein)
ProGP797 (VirB6 protein)
ProGP798 (VirB6 protein)
ProGP799 (Uncharacterized protein)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP800 (Uncharacterized protein)
ProGP801 (Uncharacterized protein)
ProGP802 (Uncharacterized protein)
ProGP803 (Carboxypeptidase 1)
ProGP804 (Uncharacterized protein)
ProGP805 (Uncharacterized protein)
ProGP806 (Uncharacterized protein)
ProGP807 (Uncharacterized protein)
ProGP808 (Fructose-1,6-bisphosphatase)
ProGP809 (Uncharacterized protein)
ProGP81 (S-layer glycoprotein)
ProGP810 (Uncharacterized protein)
ProGP811 (Uncharacterized protein)
ProGP812 (Uncharacterized protein)
ProGP813 (Uncharacterized protein)
ProGP814 (Uncharacterized protein)
ProGP815 (Uncharacterized protein)
ProGP816 (Hypothetical zinc protease)
ProGP817 (Uncharacterized protein)
ProGP818 (Uncharacterized protein)
ProGP819 (50S ribosomal protein L31)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP820 (Uncharacterized protein)
ProGP821 (Uncharacterized protein)
ProGP822 (Uncharacterized protein)
ProGP823 (Hypothetical zinc protease)
ProGP824 (Hypothetical zinc protease)
ProGP825 (Putative transferase)
ProGP826 (Zinc metalloprotease)
ProGP827 (Uncharacterized protein)
ProGP828 (Uncharacterized protein)
ProGP829 (Map1-related protein)
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP830 (Map1-related protein)
ProGP831 (3-oxoacyl-[acyl-carrier-protein] synthase 2)
ProGP832 (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ)
ProGP833 (Probable 3-hydroxyacyl-CoA dehydrogenase)
ProGP834 (Probable fructose-bisphosphate aldolase class I)
ProGP835 (Signal recognition particle protein)
ProGP836 (Methionyl-tRNA formyltransferase)
ProGP837 (Folylpolyglutamate synthase)
ProGP838 (Bifunctional protein FolD)
ProGP839 (Ribosome-recycling factor)
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP840 (Cell division protein ftsA)
ProGP841 (ATP-dependent zinc metalloprotease FtsH)
ProGP842 (DNA translocase ftsK)
ProGP843 (Signal recognition particle receptor FtsY)
ProGP844 (Cell division protein FtsZ)
ProGP845 (Fumarate hydratase class II)
ProGP846 (Fragment of Glutamyl-tRNA(Gln) amidotransferase subunit A (Duplication))
ProGP847 (Aspartyl/glutamyl-tRNA amidotransferase subunit B)
ProGP848 (Proton/sodium-glutamate symport protein)
ProGP849 (Glutamate--tRNA ligase)
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP850 (Glutamate--tRNA ligase 1)
ProGP851 (Glycine--tRNA ligase alpha subunit)
ProGP852 (Glycine--tRNA ligase beta subunit)
ProGP853 (2,3-bisphosphoglycerate-independent phosphoglycerate mutase)
ProGP854 (Glycerol-3-phosphate dehydrogenase [NAD(P)+])
ProGP855 (Transcription elongation factor)
ProGP856 (Glutaredoxin)
ProGP857 (GMP synthase [glutamine-hydrolyzing])
ProGP858 (Inosine-5'-monophosphate dehydrogenase)
ProGP859 (DNA gyrase subunit A)
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP860 (5-aminolevulinate synthase)
ProGP861 (Delta-aminolevulinic acid dehydratase)
ProGP862 (Coproporphyrinogen oxidase)
ProGP863 (Protein HflC)
ProGP864 (Protease activity modulator hflk)
ProGP865 (Histidine--tRNA ligase)
ProGP866 (ATP-dependent protease ATPase subunit HslU)
ProGP867 (ATP-dependent protease subunit HslV)
ProGP868 (Chaperone protein HtpG)
ProGP869 (Isoleucine--tRNA ligase)
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP870 (Translation initiation factor IF-1)
ProGP871 (Translation initiation factor IF-2)
ProGP872 (Translation initiation factor IF-3)
ProGP873 (Cysteine desulfurase IscS)
ProGP874 (Octaprenyl-diphosphate synthase)
ProGP875 (4-diphosphocytidyl-2-C-methyl-D-erythritol kinase)
ProGP876 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin))
ProGP877 (Glutathione-regulated potassium-efflux system protein)
ProGP878 (Elongation factor 4)
ProGP879 (Signal peptidase I)
ProGP88 (S-layer glycoprotein)
ProGP880 (Leucine--tRNA ligase)
ProGP881 (Apolipoprotein N-acyltransferase)
ProGP882 (Lon protease)
ProGP883 (Dihydrolipoyl dehydrogenase)
ProGP884 (Diaminopimelate decarboxylase)
ProGP885 (Aspartokinase)
ProGP886 (Lysine--tRNA ligase)
ProGP887 (Methionine aminopeptidase)
ProGP888 (Major antigenic protein 1)
ProGP889 (Methionine--tRNA ligase)
ProGP89 (Surface layer glycoprotein)
ProGP890 (Putative ribonucleotide transport ATP-binding protein )
ProGP891 (Lipid A export ATP-binding protein)
ProGP892 (DNA mismatch repair protein)
ProGP893 (DNA mismatch repair protein MutS)
ProGP894 (Iron-sulfur cluster assembly scaffold protein IscU)
ProGP895 (Similar to lipoprotein nlpD)
ProGP896 (Ribonucleoside-diphosphate reductase)
ProGP897 (Ribonucleoside-diphosphate reductase subunit beta)
ProGP898 (NADH-quinone oxidoreductase subunit C)
ProGP899 (NADH-quinone oxidoreductase subunit D)
ProGP9 (8 kDa fimbrae)
ProGP90 (Antigens)
ProGP900 (NADH-quinone oxidoreductase subunit F)
ProGP901 (NADH-quinone oxidoreductase chain G)
ProGP902 (NADH-quinone oxidoreductase subunit H)
ProGP903 (Transcription termination/antitermination protein NusA)
ProGP904 (Probable chromosome partitioning protein parB)
ProGP905 (Propionyl-CoA carboxylase alpha chain)
ProGP906 (Propionyl-CoA carboxylase beta chain)
ProGP907 (Pyruvate dehydrogenase E1 component, beta subunit)
ProGP908 (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
ProGP909 (Ubiquinol-cytochrome c reductase iron-sulfur subunit)
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP910 (Cytochrome b)
ProGP911 (Phosphoglycerate kinase)
ProGP912 (Phenylalanine--tRNA ligase alpha subunit)
ProGP913 (Phenylalanine--tRNA ligase beta subunit)
ProGP914 (Phosphoribosyl 1,2-cyclic phosphate phosphodiesterase)
ProGP915 (Possible 1-acyl-sn-glycerol-3-phosphate acyltransferase)
ProGP916 (Phosphate acyltransferase)
ProGP917 (PmbA protein homolog)
ProGP918 (Pyruvate, phosphate dikinase)
ProGP919 (Peptide chain release factor 1)
ProGP92 (Anitigen (1000 kDa protein))
ProGP920 (Pyrroline-5-carboxylate reductase)
ProGP921 (Proline/betaine transporter)
ProGP922 (Proline--tRNA ligase)
ProGP923 (Ribose-phosphate pyrophosphokinase)
ProGP924 (Adenylosuccinate synthetase)
ProGP925 (Phosphoribosylformylglycinamidine synthase subunit PurL)
ProGP926 (Phosphoribosylformylglycinamidine cyclo-ligase)
ProGP927 (Phosphoribosylglycinamide formyltransferase)
ProGP928 (Orotidine 5'-phosphate decarboxylase)
ProGP929 (CTP synthase)
ProGP93 (Protein complex)
ProGP930 (Uridylate kinase)
ProGP931 (Quinone oxidoreductase)
ProGP932 (DNA replication and repair protein RecF)
ProGP933 (Transcription termination factor Rho)
ProGP934 (6,7-dimethyl-8-ribityllumazine synthase)
ProGP935 (Ribonuclease E)
ProGP936 (50S ribosomal protein L1)
ProGP937 (50S ribosomal protein L6)
ProGP938 (50S ribosomal protein L9)
ProGP939 (50S ribosomal protein L18)
ProGP94 (Surface layer glycoprotein)
ProGP940 (50S ribosomal protein L25)
ProGP941 (DNA-directed RNA polymerase subunit omega)
ProGP942 (30S ribosomal protein S1)
ProGP943 (30S ribosomal protein S4)
ProGP944 (30S ribosomal protein S7)
ProGP945 (30S ribosomal protein S8)
ProGP946 (30S ribosomal protein S10)
ProGP947 (30S ribosomal protein S16)
ProGP948 (30S ribosomal protein S20)
ProGP949 (30S ribosomal protein S21)
ProGP95 (S-layer glycoprotein)
ProGP950 (Succinate dehydrogenase flavoprotein subunit)
ProGP951 (Succinate dehydrogenase iron-sulfur subunit)
ProGP952 (Protein translocase subunit SecA)
ProGP953 (Protein translocase subunit SecD)
ProGP954 (Protein translocase subunit SecY)
ProGP955 (Serine--tRNA ligase)
ProGP956 (Uncharacterized protein)
ProGP957 (Single-stranded DNA-binding protein)
ProGP958 (Inositol-1-monophosphatase)
ProGP959 (Transaldolase)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP960 (Putative thiamine biosynthesis oxidoreductase thiO)
ProGP961 (Threonine--tRNA ligase)
ProGP962 (Flavin-dependent thymidylate synthase)
ProGP963 (Trigger factor)
ProGP964 (tRNA(Ile)-lysidine synthase)
ProGP965 (Transketolase)
ProGP966 (TldD protein homolog)
ProGP967 (NADP-dependent malic enzyme)
ProGP968 (Outer membrane protein tolC)
ProGP969 (DNA topoisomerase 1)
ProGP97 (27kDa flagellin)
ProGP970 (Triosephosphate isomerase)
ProGP971 (VIRB9 protein)
ProGP972 (Thioredoxin reductase)
ProGP973 (Elongation factor Ts)
ProGP974 (GTP-binding protein TypA/BipA homolog)
ProGP975 (Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE)
ProGP976 (UvrABC system protein A)
ProGP977 (Hypothetical valine-tRNA ligase)
ProGP978 (VirB10 protein)
ProGP979 (VirD4 protein)
ProGP98 (32kDa flagellin)
ProGP980 (Ribosome-binding ATPase YchF)
ProGP981 (Membrane protein insertase YidC)
ProGP982 (Uncharacterized protein)
ProGP983 (Uncharacterized protein)
ProGP984 (Outer membrane protein assembly factor BamD)
ProGP985 (ATP-dependent Clp protease ATP-binding subunit clpA)
ProGP986 (Dihydroorotate dehydrogenase (quinone))
ProGP987 (Chromosomal replication initiator protein DnaA)
ProGP988 (Uncharacterized protein)
ProGP989 (Uncharacterized protein)
ProGP99 (PilE (pilin))
ProGP990 (Uncharacterized protein)
ProGP991 (Uncharacterized protein)
ProGP992 (Uncharacterized protein)
ProGP993 (Uncharacterized protein)
ProGP994 (Uncharacterized protein)
ProGP995 (Uncharacterized protein)
ProGP996 (Uncharacterized protein)
ProGP997 (Uncharacterized protein)
ProGP998 (Uncharacterized protein)
ProGP999 (Uncharacterized protein)
Compare ID
Choose Compare Id
ProGP1 (Envelope specific glycoprotein)
ProGP10 (Flagellin)
ProGP100 (PF sheath protein (44 kDa))
ProGP1000 (Uncharacterized protein)
ProGP1001 (VirB2 protein (homolog VirB2-8))
ProGP1002 (Uncharacterized protein)
ProGP1003 (Map1-related protein)
ProGP1004 (Map1-related protein)
ProGP1005 (Uncharacterized protein)
ProGP1006 (Enoyl-[acyl-carrier-protein] reductase [NADH])
ProGP1007 (Glyceraldehyde 3-phosphate dehydrogenase)
ProGP1008 (Chaperone protein hscA homolog)
ProGP1009 (Nucleoside diphosphate kinase)
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP1010 (Nitrogen assimilation regulatory protein NtrX)
ProGP1011 (Pyruvate dehydrogenase E1 component subunit alpha)
ProGP1012 (DNA polymerase I)
ProGP1013 (Phosphatidylserine decarboxylase proenzyme)
ProGP1014 (Probable ribonuclease D)
ProGP1015 (Putative Protease IV)
ProGP1016 (Phosphomethylpyrimidine synthase)
ProGP1017 (4-hydroxybenzoate octaprenyltransferase)
ProGP1018 (VIRB4 protein)
ProGP1019 (VirB8 protein)
ProGP102 (Flagellin B1)
ProGP1020 (Arginine--tRNA ligase)
ProGP1021 (Bacterioferritin comigratory protein)
ProGP1022 (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase)
ProGP1023 (Chaperone protein ClpB)
ProGP1024 (ATP-dependent Clp protease ATP-binding subunit ClpX)
ProGP1025 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
ProGP1026 (Enhancing lycopene biosynthesis protein 2)
ProGP1027 (Uncharacterized protein)
ProGP1028 (Uncharacterized protein)
ProGP1029 (Uncharacterized protein)
ProGP103 (Flagellin B2)
ProGP1030 (Uncharacterized protein)
ProGP1031 (Uncharacterized protein)
ProGP1032 (Uncharacterized protein)
ProGP1033 (Putative glutathione S-transferase)
ProGP1034 (Uncharacterized protein)
ProGP1035 (Uncharacterized protein)
ProGP1036 (Putative O-methyltransferase)
ProGP1037 (Probable transcriptional regulatory protein ERGA_CDS_03720)
ProGP1038 (Uncharacterized protein)
ProGP1039 (Uncharacterized protein)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP1040 (Uncharacterized protein)
ProGP1041 (Uncharacterized protein)
ProGP1042 (Hypothetical tRNA/rRNA methyltransferase)
ProGP1043 (Uncharacterized protein)
ProGP1044 (Uncharacterized protein)
ProGP1045 (Putative NADH-ubiquinone oxidoreductase subunit)
ProGP1046 (Map1-related protein)
ProGP1047 (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase)
ProGP1048 (Dihydropteroate synthase)
ProGP1049 (Possible major ferric iron binding protein)
ProGP105 (S-layer glycoprotein)
ProGP1050 (Glutamine synthetase I)
ProGP1051 (60 kDa chaperonin)
ProGP1052 (Glutaredoxin)
ProGP1053 (Ferrochelatase)
ProGP1054 (Integration host factor subunit alpha)
ProGP1055 (Possible geranyltranstransferase)
ProGP1056 (Maf-like protein EHRUM2_05950)
ProGP1057 (Malate dehydrogenase)
ProGP1058 (Quinolinate synthase A)
ProGP1059 (Nicotinate-nucleotide pyrophosphorylase)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP1060 (Multifunctional fusion protein)
ProGP1061 (NADH dehydrogenase I chain L)
ProGP1062 (Transcription termination/antitermination protein)
ProGP1063 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase)
ProGP1064 (Inorganic pyrophosphatase)
ProGP1065 (Peptide chain release factor 2)
ProGP1066 (Proline/betaine transporter)
ProGP1067 (Adenylosuccinate lyase)
ProGP1068 (Amidophosphoribosyltransferase)
ProGP1069 (Protein RecA)
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP1070 (3,4-dihydroxy-2-butanone 4-phosphate synthase)
ProGP1071 (50S ribosomal protein L13)
ProGP1072 (50S ribosomal protein L16)
ProGP1073 (DNA-directed RNA polymerase subunit alpha)
ProGP1074 (30S ribosomal protein S9)
ProGP1075 (30S ribosomal protein S19)
ProGP1076 (Protein-export protein SecB)
ProGP1077 (Protein-export membrane protein SecF)
ProGP1078 (Protein-export membrane protein SecF)
ProGP1079 (2-oxoglutarate dehydrogenase E1 component)
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP1080 (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex)
ProGP1081 (Succinyl-CoA synthetase subunit beta)
ProGP1082 (Succinyl-CoA ligase [ADP-forming] subunit alpha)
ProGP1083 (Ferredoxin--NADP reductase)
ProGP1084 (Putative Cold shock-like protein cspA)
ProGP1085 (Penicillin-binding protein dacF)
ProGP1086 (4-hydroxy-tetrahydrodipicolinate synthase)
ProGP1087 (Putative thiol:disulfide interchange protein dsbD)
ProGP1088 (Uncharacterized protein)
ProGP1089 (Uncharacterized protein)
ProGP109 (Stable protease)
ProGP1090 (Uncharacterized protein)
ProGP1091 (Uncharacterized protein)
ProGP1092 (Uncharacterized protein)
ProGP1093 (Uncharacterized protein)
ProGP1094 (Uncharacterized protein)
ProGP1095 (Uncharacterized protein)
ProGP1096 (Uncharacterized protein)
ProGP1097 (Uncharacterized protein)
ProGP1098 (Uncharacterized protein)
ProGP1099 (Uncharacterized protein)
ProGP11 (Autolysin (28 kDa))
ProGP110 (45 to 47-kDa protein)
ProGP1100 (Map1-related protein)
ProGP1101 (Uncharacterized protein)
ProGP1102 (Malonyl CoA-acyl carrier protein transacylase)
ProGP1103 (Dihydropteroate synthase)
ProGP1104 (Cell division protein FtsQ)
ProGP1105 (Citrate synthase)
ProGP1106 (Isocitrate dehydrogenase [NADP])
ProGP1107 (Outer membrane protein assembly factor BamA)
ProGP1108 (Peptidylprolyl isomerase)
ProGP1109 (Phosphate import ATP-binding protein PstB)
ProGP111 (S-layer glycoprotein)
ProGP1110 (N5-carboxyaminoimidazole ribonucleotide synthase)
ProGP1111 (Bifunctional protein PutA)
ProGP1112 (Ribose-5-phosphate isomerase)
ProGP1113 (50S ribosomal protein L19)
ProGP1114 (50S ribosomal protein L21)
ProGP1115 (50S ribosomal protein L22)
ProGP1116 (50S ribosomal protein L29)
ProGP1117 (RNA polymerase sigma factor RpoD)
ProGP1118 (Elongation factor Tu)
ProGP1119 (VirB11 protein)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP1120 (SCO3353)
ProGP1121 (SCO4307)
ProGP1122 (SCO2838)
ProGP1123 (SCO3046)
ProGP1124 (SCO4142)
ProGP1125 (SCO6558)
ProGP1126 (SCO3540)
ProGP1127 (SCO4141)
ProGP1128 (SCO5115)
ProGP1129 (SCO3357)
ProGP113 (Flagellin Laf1)
ProGP1130 (SCO4142)
ProGP1131 (SCO4968)
ProGP1132 (SCO5751)
ProGP1133 (SCO4256)
ProGP1134 (SCO5818)
ProGP1135 (SCO5776)
ProGP1136 (SCO0472)
ProGP1137 (SCO0996)
ProGP1138 (SCO1714)
ProGP1139 (SCO2035)
ProGP114 (Endo-β-N-acetylglucosaminidase F2)
ProGP1140 (SCO2096)
ProGP1141 (SCO2156)
ProGP1142 (SCO2963)
ProGP1143 (SCO3044)
ProGP1144 (SCO3046)
ProGP1145 (SCO3184)
ProGP1146 (SCO3357)
ProGP1147 (SCO3540)
ProGP1148 (SCO4130)
ProGP1149 (SCO4548)
ProGP115 (Flavastacin (P40))
ProGP1150 (SCO4739)
ProGP1151 (SCO4847)
ProGP1152 (SCO4885)
ProGP1153 (SCO4905)
ProGP1154 (SCO4934)
ProGP1155 (SCO5204)
ProGP1156 (SCO5646)
ProGP1157 (SCO5736)
ProGP1158 (SCO7218)
ProGP1159 (DsbA1 Protein)
ProGP116 (Endo-β-N-acetylglucosaminidase F3)
ProGP1160 (BCAL2640)
ProGP1161 (WTA-wall teichoic acid)
ProGP1162 (LTA- lipoteichoic acid)
ProGP1163 (Mpsy_1486)
ProGP1164 (DegP)
ProGP1165 (LspA)
ProGP1166 (SigA)
ProGP1167 (PstS1)
ProGP1168 (LprA)
ProGP1169 (LprF)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP1170 (DsbF)
ProGP1171 (Apa)
ProGP1172 (Wag31)
ProGP1173 (LppO)
ProGP1174 (Rv2799)
ProGP1175 (Mpt83)
ProGP1176 (LpqH)
ProGP1177 (EsxC)
ProGP1178 (DnaK)
ProGP1179 (OtsB1)
ProGP118 (Flagellin)
ProGP1180 (RplV)
ProGP1181 (DeaD)
ProGP1182 (InfC)
ProGP1183 (Pks5)
ProGP1184 (FadD28)
ProGP1185 (FhaA)
ProGP1186 (Rv0348)
ProGP1187 (DosT)
ProGP1188 (DesvR)
ProGP1189 (Icd2)
ProGP119 (Fimbrial protein (pilin))
ProGP1190 (Rv0216)
ProGP1191 (ThiD)
ProGP1192 (PnP)
ProGP1193 (MenH)
ProGP1194 (PurN)
ProGP1195 (PhoH2)
ProGP1196 (GlpX)
ProGP1197 (HtrA)
ProGP1198 (CarB)
ProGP1199 (GlnA1)
ProGP12 (12 kDa antigen)
ProGP120 (Protein A (cell wall glycoprotein))
ProGP1200 (AceE)
ProGP1201 (AroA)
ProGP1202 (SahH)
ProGP1203 (Rv3273)
ProGP1204 (Rv0311)
ProGP1205 (Rv0566c)
ProGP1206 (Rv1352)
ProGP1207 (Rv1466)
ProGP1208 (Rv2166c)
ProGP1209 (Rv2558)
ProGP121 (Surface layer glycoprotein Sat B)
ProGP1210 (Rv2826c)
ProGP1211 (Rv3491)
ProGP1212 (BCAL0114 (FliC))
ProGP1213 (BCAL0129 (CheA))
ProGP1214 (BCAL0524 (FliG))
ProGP1215 (BCAL0525 (FliF))
ProGP1216 (HuvA)
ProGP1217 (AidA)
ProGP1218 (SLP-5818)
ProGP1219 (SLP-5818)
ProGP122 (Surface layer glycoprotein SatA)
ProGP1220 (SLP-8321)
ProGP1221 (SLP-8348)
ProGP1222 (BTL2)
ProGP1223 (FlaB1)
ProGP1224 (FlaB2)
ProGP1225 (FlaB3)
ProGP1226 (FlaB4)
ProGP1227 (Fla A)
ProGP1228 (Acm2)
ProGP1229 (GkFlaA1)
ProGP123 (CRX (Copper response extracellular protein))
ProGP1230 (GkFlaA2)
ProGP1231 (CbFla)
ProGP1232 (Flagella)
ProGP1233 (SvC)
ProGP1234 (Conserved hypothetical protein)
ProGP1235 (DUF192 family protein)
ProGP1236 (Thermosome subunit 3)
ProGP1237 (ABC-type transport system periplasmic substrate-binding protein (probable substrate))
ProGP1238 (Pilin PilA)
ProGP1239 (Cox-type terminal oxidase subunit II)
ProGP124 (β-1,4-mannanase)
ProGP1240 (DUF4382 domain protein)
ProGP1241 (Conserved hypothetical protein)
ProGP1242 (Archaellin A1)
ProGP1243 (Archaellin A2)
ProGP1244 (Conserved hypothetical protein)
ProGP1245 (Dolichyl-monophosphooligosaccharide— protein glycotransferase AglB)
ProGP1246 (Conserved hypothetical protein)
ProGP1247 (Conserved hypothetical protein)
ProGP1248 (Conserved hypothetical protein)
ProGP1249 (Peptidase M10 family protein)
ProGP125 (Flagellin)
ProGP1250 (Conserved hypothetical protein)
ProGP1251 (M50 family metalloprotease)
ProGP1252 (Probable transmembrane glycoprotein/HTH domain protein)
ProGP1253 (Conserved hypothetical protein)
ProGP1254 (Protein-export membrane protein SecD)
ProGP1255 (GATase domain protein)
ProGP1256 (Pilin PilA)
ProGP1257 (Conserved hypothetical protein)
ProGP1258 (Conserved hypothetical protein)
ProGP1259 (Probable secreted glycoprotein)
ProGP126 (31/33 kDa flagellin)
ProGP1260 (SLG)
ProGP1261 (Probable secreted glycoprotein)
ProGP1262 (Probable secreted glycoprotein (nonfunctional))
ProGP1263 (Pectin lyase domain protein)
ProGP1264 (Conserved hypothetical protein)
ProGP1265 (ABC-type transport system permease protein (probable substrate macrolides))
ProGP1266 (Probable secreted glycoprotein)
ProGP1267 (Probable secreted glycoprotein)
ProGP1268 (Conserved hypothetical protein)
ProGP1269 (Conserved hypothetical protein)
ProGP127 (Flagellin B1 (41 kDa))
ProGP1270 (DUF1616 family protein)
ProGP1271 (Conserved hypothetical protein)
ProGP1272 (Conserved hypothetical protein)
ProGP1273 (Conserved hypothetical protein)
ProGP1274 (Conserved hypothetical protein)
ProGP1275 (Conserved hypothetical protein)
ProGP1276 (Conserved hypothetical protein)
ProGP1277 (LppX domain protein)
ProGP1278 (Hypothetical protein)
ProGP1279 (Conserved hypothetical protein)
ProGP128 (wmA (S-layer protein))
ProGP1280 (Probable transmembrane glycoprotein/HTH domain protein)
ProGP1281 (DNA-directed RNA polymerase subunit A’)
ProGP1282 (Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3)
ProGP1283 (50S ribosomal protein L43e)
ProGP1284 (Aspartate–tRNA(Asp/Asn) ligase)
ProGP1285 (Glutamate synthase (ferredoxin) large subunit)
ProGP1286 (30S ribosomal protein S15)
ProGP1287 (UspA domain protein)
ProGP1288 (Conserved hypothetical protein)
ProGP1289 (Probable phosphoribosyltransferase (homolog to anthranilate phosphoribosyltransferase))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP1290 (Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3)
ProGP1291 (Aspartate-semialdehyde dehydrogenase)
ProGP1292 (L-aspartate oxidase)
ProGP1293 (ABC-type transport system periplasmic substrate-binding protein (probable substrate dipeptide/oligopeptide))
ProGP1294 (ATP-dependent cobaltochelatase subunit CobN)
ProGP1295 (Pyruvate Kinase)
ProGP1296 (3-mthyl-2-oxobutanoate hydroxymethyl-transferase)
ProGP1297 (Pilin PilA)
ProGP1298 (Flagella)
ProGP1299 (S-layer glycoprotein (SlpA))
ProGP13 (33 kDa antigen)
ProGP130 (Pyrolysin)
ProGP1300 (FljK, Flagellin protein)
ProGP1301 (FljK, Flagellin protein)
ProGP1302 (NagC)
ProGP1303 (GlmR)
ProGP1304 (Hypothetical protein, CHU_2708)
ProGP1305 (Cel9A)
ProGP1306 (Pilin protein)
ProGP1307 (PilA)
ProGP1308 (AlpA/B)
ProGP1309 (BabA/B)
ProGP131 (Cell surface phosphatase)
ProGP1310 (SLP, S-layer protein)
ProGP1311 (Thread (Fourth filament))
ProGP1312 (PilE)
ProGP1313 (PilE)
ProGP1314(S-layer Protein, SLG)
ProGP132 (Chondroitinase-AC)
ProGP133 (Heparinase II)
ProGP134 (Exopolymer)
ProGP135 (37-kDa protein)
ProGP136 (Antigen (60 kDa))
ProGP137 (Oscillin (65.8 kDa))
ProGP138 (Cell surface glycoprotein)
ProGP139 (S-layer glycoprotein)
ProGP14 (Membrane glycoprotein)
ProGP140 (α-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP142 (Antifreeze protein)
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP145 (Adhesion inhibitor)
ProGP146 (Flagellin)
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP148 (β-1,4-mannanase (G-enzyme))
ProGP149 (Crystal toxin (66 kDa))
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP152 (Type A Flagellin)
ProGP153 (Flagellin)
ProGP154 (Flagellin)
ProGP155 (Flagellin)
ProGP156 (AnAF)
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP158 (FlaB (flagellar core protein))
ProGP159 (FlaB (flagellar core protein))
ProGP16 (50 kDa antigen)
ProGP160 (Flagellar filament 31.3 kDa core protein)
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP164 (FlaB (flagellar core protein))
ProGP165 (S-layer glycopeptide)
ProGP166 (Chondroitinase-B)
ProGP167 (BclA (collagen-like protein))
ProGP168 (Slp (S-layer glycoprotein))
ProGP169 (Surface layer glycoproteins)
ProGP17 (Flagellin)
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP172 (S-layer glycoprotein)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP174 (Flagellin A)
ProGP175 (Flagellin B)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP177 (HRgpA)
ProGP178 (mtRgpA)
ProGP179 (S-layer glycoprotein)
ProGP18 (S-layer glycoprotein SgsE)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP185 (Invertase)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP187 (flaA)
ProGP188 (flaB)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP190 (LppN lipoprotein)
ProGP191 (LppQ lipoprotein)
ProGP192 (LpqH)
ProGP193 (PstS1)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP196 (ComP)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP198 (Flagellin)
ProGP199 (Flagellin)
ProGP2 (Phytotoxin)
ProGP20 (Outer membrane protein (50 kDa))
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP205 (Flagellin A (FlaA))
ProGP206 (Flagellin (FlaA))
ProGP207 (Glycopeptidolipid (GPL))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP21 (Outer membrane protein (75 kDa))
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP213 (95-kDa glycoprotein)
ProGP214 (Flagellin B)
ProGP215 (Flagellin A (FlaA))
ProGP216 (BclA (collagen-like protein))
ProGP217 (AcrA or CmeA)
ProGP218 (CgpA)
ProGP219 (Cj0114)
ProGP22 (Flagellin FlaB1)
ProGP220 (Cj0200c)
ProGP221 (Cj1496c)
ProGP222 (PEB3)
ProGP223 (ZnuA)
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP227 (HMW1 (Adhesin))
ProGP228 (Short glycopeptides)
ProGP229 (GspB)
ProGP23 (Flagellin FlaB2)
ProGP230 (PilA (Type IV pilin))
ProGP231 (VirB10 protein)
ProGP232 (Flagellin FlaA)
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP234 (CipA (conserved hypothetical protein))
ProGP235 (CipB (putative dipeptide-binding protein
ProGP236 (HisJ)
ProGP237 (SgtA)
ProGP238 (FlaB1)
ProGP239 (FlaB2)
ProGP24 (Flagellin FlaB3)
ProGP240 (FlaB3)
ProGP241 (FlaA)
ProGP242 (S-layer protein)
ProGP243 (Synthetic Glycopeptide)
ProGP244 (SrpA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP248 (Flagellin B)
ProGP249 (Ag43 α (Antigen 43 passenger domain))
ProGP25 (33 and 34 kDa antigens)
ProGP250 (PilA (Pilin))
ProGP251 (Type b Flagellin)
ProGP252 (DgpA)
ProGP253 (DgpC)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP255 (HmcA)
ProGP256 (CmeC)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP258 (FlaB3)
ProGP259 (FlaB1)
ProGP26 (CenA (Endoglucanase A))
ProGP260 (FlaB2)
ProGP261 (Flagellin (FlaA))
ProGP262 (Pillin (Group IV))
ProGP263 (Rv3491)
ProGP264 (Glycosyl hydrolase)
ProGP265 (Rv2799)
ProGP266 (LprA)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP270 (BlaC)
ProGP271 (FecB)
ProGP272 (LppL)
ProGP273 (LppX (Putative lipoprotein))
ProGP274 (LppZ (Putative lipoprotein))
ProGP275 (LpqB lipoprotein)
ProGP276 (LpqF lipoprotein)
ProGP277 (LpqI)
ProGP278 (LpqN)
ProGP279 (LpqT (putative lipoprotein))
ProGP28 (Flagellin A1)
ProGP280 (LpqW (lipoprotein))
ProGP281 (LprF)
ProGP282 (prG)
ProGP283 (OppA)
ProGP284 (PonA2)
ProGP285 (PpiB)
ProGP286 (PstS2)
ProGP287 (PstS3)
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP29 (Flagellin A2)
ProGP290 (Rv0907)
ProGP291 (Rv0988)
ProGP292 (Rv1084)
ProGP293 (Rv2813)
ProGP294 (Secreted protease)
ProGP295 (Thioredoxin)
ProGP296 (FlaA (Flagellin))
ProGP297 (FlaB (Flagellin))
ProGP298 (FliC (Flagellin subunit))
ProGP299 (CcoP)
ProGP3 (S-layer glycoprotein)
ProGP30 (Flagellin B1)
ProGP300 (CycB)
ProGP301 (S-layer Protein)
ProGP302 (AniA)
ProGP303 (DsbA)
ProGP304 (Gna1946)
ProGP305 (Laz)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP307 (PotF)
ProGP308 (Sco)
ProGP309 (PstS (40 kDa))
ProGP31 (Flagellin B2)
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP313 (Hypothetical protein)
ProGP314 (Putative exported protein)
ProGP315 (Putative outer membrane protein)
ProGP316 (Srr1)
ProGP317 (BF3567)
ProGP318 (BF3918)
ProGP319 (BF0935)
ProGP32 (Flagellin B3)
ProGP320 (LppC)
ProGP321 (OmpA)
ProGP322 (EtpA Adhesin)
ProGP323 (JlpA (42-45 kDa antigen))
ProGP324 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP326 (FliC (Flagellin))
ProGP327 (LccA, an Archaeal Laccase)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP329 (FTH_1830)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP330 (FTH_0159)
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP334 (FTH_0311)
ProGP335 (FTH_1167)
ProGP336 (FTH_1761)
ProGP337 (FTH_1721)
ProGP338 (FTH_1293)
ProGP339 (FTH_0069)
ProGP34 (S-layer glycoprotein)
ProGP340 (FTH_1071)
ProGP341 (FTH_0414)
ProGP342 (FTH_0357)
ProGP343 (PilA (FTH_0384))
ProGP344 (SlaA (S-layer protein))
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP346 (Chondroitinase ABC)
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP348 (TfsB (S-layer protein))
ProGP349 (TF1259)
ProGP35 (β-1,4-Endoglucanases)
ProGP350 (TF2339)
ProGP351 (BF0810)
ProGP352 (Putative cell division protein)
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP357 (Putative lipoprotein)
ProGP358 (Putative membrane protein)
ProGP359 (Putative membrane protein)
ProGP36 (S-layer glycoprotein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP362 (Putative sulfatase family protein)
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP364 (Putative integral membrane protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP367 (Putative uncharacterized protein)
ProGP368 (Colicin V production protein)
ProGP369 (Putative membrane protein)
ProGP37 (S-layer glycoprotein)
ProGP370 (Putative exporting protein)
ProGP371 (Putative secreted protease)
ProGP372 (Putative periplasmic protein)
ProGP373 (Putative periplasmic protein)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP377 (Putative periplasmic protein)
ProGP378 (Putative membrane protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP38 (VGP (74 kDa))
ProGP380 (Putative periplasmic protein)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP382 (Putative secreted transglycosylase)
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP389 (Putative integral membrane protein)
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP390 (Putative sulfatase protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP392 (Putative periplasmic protein)
ProGP393 (Putative integral membrane protein)
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP399 (TfsA (S-layer protein))
ProGP4 (F-pilin)
ProGP40 (Long-fibril protein (LFP))
ProGP400 (Sublancin)
ProGP401 (Plantaricin ASM1)
ProGP402 (Glycocin F)
ProGP403 (FlaA (Flagellin))
ProGP404 (FlaB (Flagellin))
ProGP405 (TF0091)
ProGP406 (TF1056)
ProGP407 (EhaJ (autotranporter))
ProGP408 (FliC (Flagellin))
ProGP409 (FliC (Flagellin))
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP410 (DsbA)
ProGP411 (FTL_1096)
ProGP412 (OmpA/MotB)
ProGP413 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP416 (Putative Uncharacterized Protein)
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP42 (Cellobiosidase)
ProGP420 (FlaA (Polar flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP422 (LafA (Lateral flagellin))
ProGP423 (AniA)
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP425 (ABC Transporter (TreS))
ProGP426 (Oligopeptide binding protein)
ProGP427 (Hypothetical protein)
ProGP428 (Protease)
ProGP429 (Maltose ABC transporter)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP430 (Serine protease)
ProGP431 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP433 (Hypothetical protein)
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP435 (FasC (fasciclin domain protein))
ProGP436 (Acm2)
ProGP437 (FliC (Type B Flagellin))
ProGP438 (DnaK)
ProGP439 (Lp_2260)
ProGP44 (S-layer glycoprotein)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP442 (PdhC)
ProGP443 (FtsY)
ProGP444 (Lp_ 2793)
ProGP445 (FtsK1)
ProGP446 (Lp_3421)
ProGP447 (FtsZ)
ProGP448 (MOMP)
ProGP449 (PsrP (Adhesin))
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP450 (AtaC)
ProGP451 (COK_1394)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP454 (Rv1887)
ProGP455 (35kDa protein)
ProGP456 (Rv3835)
ProGP457 (LppO (Putative lipoprotein))
ProGP458 (ThuA)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP463 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP466 (Putative protein)
ProGP467 (Alanine and proline-rich secreted protein)
ProGP468 (C-terminal protease)
ProGP469 (MdtA multidrug resistance protein)
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP470 (Putative uncharacterized protein)
ProGP471 (Putative uncharacterized protein)
ProGP472 (Putative signal peptide)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP475 (Putative uncharacterized protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP477 (Putative cell division related protein)
ProGP478 (Putative uncharacterized protein)
ProGP479 (Putative lipoprotein)
ProGP48 (S-layer glycoprotein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP481 (CpxP-like protein)
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprotein)
ProGP484 (Putative exported protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP486 (Putative membrane protein)
ProGP487 (OM lipoprotein carrier LolA)
ProGP488 (OmlA)
ProGP489 (Cell division protein)
ProGP49 (S-layer glycoprotein)
ProGP490 (OmpA family protein)
ProGP491 (Putative uncharacterized protein)
ProGP492 (Type IV Pilin)
ProGP493 (CN)
ProGP494 (FliC (Flagellin))
ProGP495 (EF-P)
ProGP496 (PliA)
ProGP497 (Putative secretion protein)
ProGP498 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP5 (Factor PG-1)
ProGP50 (Flagellin A)
ProGP500 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP502 (Uncharacterized protein)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP506 (MetQ)
ProGP507 (Sco)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP509 (Ccop)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP510 (Translation elongation factor P (EF-P))
ProGP511 (Translation elongation factor P (EF-P))
ProGP512 (Enterocin F4-9)
ProGP513 (Knh)
ProGP514 (EmaA)
ProGP515 (NirK)
ProGP516 (C5)
ProGP517 (CcoP)
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP52 (Hypothetical protein)
ProGP520 (Hag flagellin)
ProGP521 (EF-P)
ProGP522 (Putative membrane fusion protein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP528 (FtsN)
ProGP529 (AcrA)
ProGP53 (33 kDa minor core flagellin)
ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrolase)
ProGP531 (Probable transmembrane protein)
ProGP532 (Probable serine protease protein)
ProGP533 (Probable m20-related peptidase)
ProGP534 (PilN)
ProGP535 (Probable lipoprotein)
ProGP536 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP538 (Probable transmembrane protein)
ProGP539 (PilA)
ProGP54 (34 kDa major core flagellin)
ProGP540 (Probable peptidase transmembrane protein)
ProGP541 (FtsL)
ProGP542 (Translation elongation factor P (EF-P))
ProGP543 (Flagellin A1)
ProGP544 (Flagellin A2)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP548 (Pilin A4)
ProGP549 (Pilin A6)
ProGP55 (Cell surface protein/S-layer protein)
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP553 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP555 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP557 (Hypothetical protein)
ProGP558 (ABC transporter substrate binding protei
ProGP559 (Pullulanase)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP560 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP562 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP564 (Hypothetical protein)
ProGP565 (Peptide binding protein)
ProGP566 (Multidrug RND transporter)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP57 (38 kDa antigen)
ProGP570 (Peptide transporter)
ProGP571 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP573 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP575 (Hypothetical protein)
ProGP576 (Penicillin amidase)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP578 (Cytochrome c biogenesis protein)
ProGP579 (Hypothetical protein)
ProGP58 (Thermopsin)
ProGP580 (Histidine kinase)
ProGP581 (Cytochrome c assembly)
ProGP582 (Metallophosphoesterase)
ProGP583 (ATP synthase subunit A)
ProGP584 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP586 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP59 (β-1, 4-D-glucosidase (51 kDa))
ProGP590 (Hypothetical protein)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP592 (Peptidase)
ProGP593 (Hypothetical protein)
ProGP594 (ABC transporter substrate binding protei
ProGP595 (Glycosyl transferase)
ProGP596 (Nitrate reductase beta subunit)
ProGP597 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP599 (Hypothetical protein)
ProGP6 (Cellulase CA)
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP600 (Hypothetical protein)
ProGP601 (Transglutaminase)
ProGP602 (FAD-dependent oxidoreductase)
ProGP603 (ABC transporter substrate binding protein)
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein)
ProGP606 (ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP609 (Hypothetical protein)
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP613 (Nitrous oxidase accessory protein)
ProGP614 (Glutamate dehydrogenase)
ProGP615 (Hypothetical protein)
ProGP616 (NADH dehydrogenase subunit D)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP618 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP62 (18 kDa and 32 kDa lectin binding proteins)
ProGP620 (Hypothetical protein)
ProGP621 (Sugar binding protein)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP623 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP625 (Hypothetical protein)
ProGP626 (Serpin)
ProGP627 (Hypothetical protein)
ProGP628 (ABC transporter substrate binding protein)
ProGP629 (ATPase)
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP630 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP634 (Peptide ABC transporter permease)
ProGP635 (TRAP ABC transporter)
ProGP636 (NosD)
ProGP637 (Cytochrome c biogenesis protein)
ProGP638 (Excisionase)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP640 (Primosomal protein)
ProGP641 (Hypothetical protein)
ProGP642 (Cytochrome c assembly protein)
ProGP643 (Glycosyltransferase)
ProGP644 (Hypothetical protein)
ProGP645 (ABC transporter substrate binding protein)
ProGP646 (Glycosyltransferase)
ProGP647 (Hypothetical protein)
ProGP648 (Nitrate reductase)
ProGP649 (Transcriptional regulator)
ProGP65 (24 kDa flagellin)
ProGP650 (Hypothetical protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP656 (RNA methyltransferase)
ProGP657 (Transcriptional regulator)
ProGP658 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP66 (25 kDa flagellin)
ProGP660 (Hypothetical protein)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP662 (30S ribosomal protein S2)
ProGP663 (Protein disulfide isomerase like protein)
ProGP664 (V-type ATPase subunit D)
ProGP665 (ABC transporter)
ProGP666 (ABC transporter)
ProGP667 (V-type ATP synthase subunit E)
ProGP668 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP67 (35 kDa flagellin)
ProGP670 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP672 (Hypothetical protein)
ProGP673 (FHA domain containing protein)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP678 (Hypothetical protein)
ProGP679 (Nitrate reductase alpha subunit)
ProGP68 (S-layer glycoprotein)
ProGP680 (Peptidase S8)
ProGP681 (Formate dehydrogenase)
ProGP682 (Flagellin)
ProGP683 (Flagellin)
ProGP684 (S-layer glycoprotein (pNG5138))
ProGP685 (Msp1)
ProGP686 (Ta0280)
ProGP687 (Ta1063)
ProGP688 (Ta1052)
ProGP689 (Ta0171)
ProGP69 (S-layer glycoprotein)
ProGP690 (Ta0261)
ProGP691 (Kustd1514)
ProGP692 (SpaCBA)
ProGP693 (Serine rich-repeat SrpA)
ProGP694 (Serine rich-repeat SrpB)
ProGP695 (Serine rich-repeat SrpC)
ProGP696 (WpaA)
ProGP697 (Cnm)
ProGP698 (HgpA)
ProGP699 (Cellulose A)
ProGP7 (Cellulase CB)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP700 (SlpA protein)
ProGP701 (hypothetical protein)
ProGP702 (hypothetical protein)
ProGP703 (Bacillicin CER074)
ProGP704 (Bacillicin BAG2O)
ProGP705 (Geocillicin)
ProGP706 (Listeriocytocin)
ProGP707 (CleA)
ProGP708 (WTA-wall teichoic acid)
ProGP709 (PalA)
ProGP71 (S-layer glycoprotein)
ProGP710 (Hyp1)
ProGP711 (Hyp2)
ProGP712 (Asm1)
ProGP713 (SRRP100-23)
ProGP714 (SRRP53608)
ProGP715 (LpqH)
ProGP716 (AcpM)
ProGP717 (Uncharacterized protein)
ProGP718 (Uncharacterized protein)
ProGP719 (Uncharacterized protein)
ProGP72 (Alkaline Phosphatase D)
ProGP720 (Aminotransferase)
ProGP721 (Aconitate hydratase)
ProGP722 (Acyl carrier protein)
ProGP723 (Adenylate kinase)
ProGP724 (Alanine--tRNA ligase)
ProGP725 (Alkaline protease secretion ATP-binding protein AprD)
ProGP726 (Alkaline protease secretion protein)
ProGP727 (N-acetyl-gamma-glutamyl-phosphate reductase)
ProGP728 (Ornithine carbamoyltransferase)
ProGP729 (Argininosuccinate synthase)
ProGP73 (p115/ PAAP)
ProGP730 (Argininosuccinate lyase)
ProGP731 (Arginine biosynthesis bifunctional protein ArgJ)
ProGP732 (Aspartate-semialdehyde dehydrogenase)
ProGP733 (Aspartate--tRNA(Asp/Asn) ligase)
ProGP734 (Putative ATP synthase epsilon chain 2)
ProGP735 (ATP synthase gamma chain)
ProGP736 (ATP synthase subunit delta)
ProGP737 (ATP synthase B chain)
ProGP738 (Carbamoyl-phosphate synthase small chain)
ProGP739 (Carbamoyl-phosphate synthase large chain)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP740 (ATP-dependent Clp protease proteolytic subunit)
ProGP741 (Cytochrome c oxidase subunit 2)
ProGP742 (Cytochrome c oxidase subunit 1)
ProGP743 (Cytochrome c homolog)
ProGP744 (Cysteine--tRNA ligase)
ProGP745 (4-hydroxy-tetrahydrodipicolinate reductase)
ProGP746 (Peptide deformylase)
ProGP747 (DNA/pantothenate metabolism flavoprotein homolog)
ProGP748 (Chaperone protein DnaJ)
ProGP749 (DNA polymerase III subunit beta)
ProGP75 (S-layer glycoprotein)
ProGP750 (DNA polymerase III subunit gamma/tau)
ProGP751 (Deoxyuridine 5'-triphosphate nucleotidohydrolase)
ProGP752 ((Dimethylallyl)adenosine tRNA methylthiotransferase)
ProGP753 (GTPase Der)
ProGP754 (Enolase)
ProGP755 (Hemolysin cluster)
ProGP756 (VirB8 protein)
ProGP757 (Uncharacterized protein)
ProGP758 (Uncharacterized protein)
ProGP759 (Uncharacterized protein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP760 (Uncharacterized protein)
ProGP761 (Uncharacterized protein)
ProGP762 (Uncharacterized protein)
ProGP763 (Uncharacterized protein)
ProGP764 (Uncharacterized protein)
ProGP765 (Uncharacterized protein)
ProGP766 (Uncharacterized protein)
ProGP767 (Uncharacterized protein)
ProGP768 (ABC transporter substrate binding protein)
ProGP769 (Uncharacterized protein)
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP770 (Uncharacterized protein)
ProGP771 (Uncharacterized protein)
ProGP772 (Uncharacterized protein)
ProGP773 (uncha/CBS/transporter associated domain protein)
ProGP774 (Histidine kinase PleC)
ProGP775 (Uncharacterized protein)
ProGP776 (Uncharacterized protein)
ProGP777 (Uncharacterized protein)
ProGP778 (Uncharacterized protein)
ProGP779 (Putative regulatory component of sensory transduction system PleD)
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP780 (Uncharacterized protein)
ProGP781 (Uncharacterized protein)
ProGP782 (Uncharacterized protein)
ProGP783 (Deoxyguanosinetriphosphate triphosphohydrolase-like protein)
ProGP784 (Probable sigma(54) modulation protein)
ProGP785 (Uncharacterized protein)
ProGP786 (Uncharacterized protein)
ProGP787 (Uncharacterized protein)
ProGP788 (Uncharacterized protein)
ProGP789 (Uncharacterized protein)
ProGP79 (S-layer glycoprotein)
ProGP790 (Uncharacterized protein)
ProGP791 (Probable aminoglycoside efflux pump (Acriflavine resistance protein D))
ProGP792 (Similar to human and bovine Cytochrome c1)
ProGP793 (Uncharacterized protein)
ProGP794 (Uncharacterized protein)
ProGP795 (VirB6 protein)
ProGP796 (VirB6 protein)
ProGP797 (VirB6 protein)
ProGP798 (VirB6 protein)
ProGP799 (Uncharacterized protein)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP800 (Uncharacterized protein)
ProGP801 (Uncharacterized protein)
ProGP802 (Uncharacterized protein)
ProGP803 (Carboxypeptidase 1)
ProGP804 (Uncharacterized protein)
ProGP805 (Uncharacterized protein)
ProGP806 (Uncharacterized protein)
ProGP807 (Uncharacterized protein)
ProGP808 (Fructose-1,6-bisphosphatase)
ProGP809 (Uncharacterized protein)
ProGP81 (S-layer glycoprotein)
ProGP810 (Uncharacterized protein)
ProGP811 (Uncharacterized protein)
ProGP812 (Uncharacterized protein)
ProGP813 (Uncharacterized protein)
ProGP814 (Uncharacterized protein)
ProGP815 (Uncharacterized protein)
ProGP816 (Hypothetical zinc protease)
ProGP817 (Uncharacterized protein)
ProGP818 (Uncharacterized protein)
ProGP819 (50S ribosomal protein L31)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP820 (Uncharacterized protein)
ProGP821 (Uncharacterized protein)
ProGP822 (Uncharacterized protein)
ProGP823 (Hypothetical zinc protease)
ProGP824 (Hypothetical zinc protease)
ProGP825 (Putative transferase)
ProGP826 (Zinc metalloprotease)
ProGP827 (Uncharacterized protein)
ProGP828 (Uncharacterized protein)
ProGP829 (Map1-related protein)
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP830 (Map1-related protein)
ProGP831 (3-oxoacyl-[acyl-carrier-protein] synthase 2)
ProGP832 (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ)
ProGP833 (Probable 3-hydroxyacyl-CoA dehydrogenase)
ProGP834 (Probable fructose-bisphosphate aldolase class I)
ProGP835 (Signal recognition particle protein)
ProGP836 (Methionyl-tRNA formyltransferase)
ProGP837 (Folylpolyglutamate synthase)
ProGP838 (Bifunctional protein FolD)
ProGP839 (Ribosome-recycling factor)
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP840 (Cell division protein ftsA)
ProGP841 (ATP-dependent zinc metalloprotease FtsH)
ProGP842 (DNA translocase ftsK)
ProGP843 (Signal recognition particle receptor FtsY)
ProGP844 (Cell division protein FtsZ)
ProGP845 (Fumarate hydratase class II)
ProGP846 (Fragment of Glutamyl-tRNA(Gln) amidotransferase subunit A (Duplication))
ProGP847 (Aspartyl/glutamyl-tRNA amidotransferase subunit B)
ProGP848 (Proton/sodium-glutamate symport protein)
ProGP849 (Glutamate--tRNA ligase)
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP850 (Glutamate--tRNA ligase 1)
ProGP851 (Glycine--tRNA ligase alpha subunit)
ProGP852 (Glycine--tRNA ligase beta subunit)
ProGP853 (2,3-bisphosphoglycerate-independent phosphoglycerate mutase)
ProGP854 (Glycerol-3-phosphate dehydrogenase [NAD(P)+])
ProGP855 (Transcription elongation factor)
ProGP856 (Glutaredoxin)
ProGP857 (GMP synthase [glutamine-hydrolyzing])
ProGP858 (Inosine-5'-monophosphate dehydrogenase)
ProGP859 (DNA gyrase subunit A)
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP860 (5-aminolevulinate synthase)
ProGP861 (Delta-aminolevulinic acid dehydratase)
ProGP862 (Coproporphyrinogen oxidase)
ProGP863 (Protein HflC)
ProGP864 (Protease activity modulator hflk)
ProGP865 (Histidine--tRNA ligase)
ProGP866 (ATP-dependent protease ATPase subunit HslU)
ProGP867 (ATP-dependent protease subunit HslV)
ProGP868 (Chaperone protein HtpG)
ProGP869 (Isoleucine--tRNA ligase)
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP870 (Translation initiation factor IF-1)
ProGP871 (Translation initiation factor IF-2)
ProGP872 (Translation initiation factor IF-3)
ProGP873 (Cysteine desulfurase IscS)
ProGP874 (Octaprenyl-diphosphate synthase)
ProGP875 (4-diphosphocytidyl-2-C-methyl-D-erythritol kinase)
ProGP876 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin))
ProGP877 (Glutathione-regulated potassium-efflux system protein)
ProGP878 (Elongation factor 4)
ProGP879 (Signal peptidase I)
ProGP88 (S-layer glycoprotein)
ProGP880 (Leucine--tRNA ligase)
ProGP881 (Apolipoprotein N-acyltransferase)
ProGP882 (Lon protease)
ProGP883 (Dihydrolipoyl dehydrogenase)
ProGP884 (Diaminopimelate decarboxylase)
ProGP885 (Aspartokinase)
ProGP886 (Lysine--tRNA ligase)
ProGP887 (Methionine aminopeptidase)
ProGP888 (Major antigenic protein 1)
ProGP889 (Methionine--tRNA ligase)
ProGP89 (Surface layer glycoprotein)
ProGP890 (Putative ribonucleotide transport ATP-binding protein )
ProGP891 (Lipid A export ATP-binding protein)
ProGP892 (DNA mismatch repair protein)
ProGP893 (DNA mismatch repair protein MutS)
ProGP894 (Iron-sulfur cluster assembly scaffold protein IscU)
ProGP895 (Similar to lipoprotein nlpD)
ProGP896 (Ribonucleoside-diphosphate reductase)
ProGP897 (Ribonucleoside-diphosphate reductase subunit beta)
ProGP898 (NADH-quinone oxidoreductase subunit C)
ProGP899 (NADH-quinone oxidoreductase subunit D)
ProGP9 (8 kDa fimbrae)
ProGP90 (Antigens)
ProGP900 (NADH-quinone oxidoreductase subunit F)
ProGP901 (NADH-quinone oxidoreductase chain G)
ProGP902 (NADH-quinone oxidoreductase subunit H)
ProGP903 (Transcription termination/antitermination protein NusA)
ProGP904 (Probable chromosome partitioning protein parB)
ProGP905 (Propionyl-CoA carboxylase alpha chain)
ProGP906 (Propionyl-CoA carboxylase beta chain)
ProGP907 (Pyruvate dehydrogenase E1 component, beta subunit)
ProGP908 (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
ProGP909 (Ubiquinol-cytochrome c reductase iron-sulfur subunit)
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP910 (Cytochrome b)
ProGP911 (Phosphoglycerate kinase)
ProGP912 (Phenylalanine--tRNA ligase alpha subunit)
ProGP913 (Phenylalanine--tRNA ligase beta subunit)
ProGP914 (Phosphoribosyl 1,2-cyclic phosphate phosphodiesterase)
ProGP915 (Possible 1-acyl-sn-glycerol-3-phosphate acyltransferase)
ProGP916 (Phosphate acyltransferase)
ProGP917 (PmbA protein homolog)
ProGP918 (Pyruvate, phosphate dikinase)
ProGP919 (Peptide chain release factor 1)
ProGP92 (Anitigen (1000 kDa protein))
ProGP920 (Pyrroline-5-carboxylate reductase)
ProGP921 (Proline/betaine transporter)
ProGP922 (Proline--tRNA ligase)
ProGP923 (Ribose-phosphate pyrophosphokinase)
ProGP924 (Adenylosuccinate synthetase)
ProGP925 (Phosphoribosylformylglycinamidine synthase subunit PurL)
ProGP926 (Phosphoribosylformylglycinamidine cyclo-ligase)
ProGP927 (Phosphoribosylglycinamide formyltransferase)
ProGP928 (Orotidine 5'-phosphate decarboxylase)
ProGP929 (CTP synthase)
ProGP93 (Protein complex)
ProGP930 (Uridylate kinase)
ProGP931 (Quinone oxidoreductase)
ProGP932 (DNA replication and repair protein RecF)
ProGP933 (Transcription termination factor Rho)
ProGP934 (6,7-dimethyl-8-ribityllumazine synthase)
ProGP935 (Ribonuclease E)
ProGP936 (50S ribosomal protein L1)
ProGP937 (50S ribosomal protein L6)
ProGP938 (50S ribosomal protein L9)
ProGP939 (50S ribosomal protein L18)
ProGP94 (Surface layer glycoprotein)
ProGP940 (50S ribosomal protein L25)
ProGP941 (DNA-directed RNA polymerase subunit omega)
ProGP942 (30S ribosomal protein S1)
ProGP943 (30S ribosomal protein S4)
ProGP944 (30S ribosomal protein S7)
ProGP945 (30S ribosomal protein S8)
ProGP946 (30S ribosomal protein S10)
ProGP947 (30S ribosomal protein S16)
ProGP948 (30S ribosomal protein S20)
ProGP949 (30S ribosomal protein S21)
ProGP95 (S-layer glycoprotein)
ProGP950 (Succinate dehydrogenase flavoprotein subunit)
ProGP951 (Succinate dehydrogenase iron-sulfur subunit)
ProGP952 (Protein translocase subunit SecA)
ProGP953 (Protein translocase subunit SecD)
ProGP954 (Protein translocase subunit SecY)
ProGP955 (Serine--tRNA ligase)
ProGP956 (Uncharacterized protein)
ProGP957 (Single-stranded DNA-binding protein)
ProGP958 (Inositol-1-monophosphatase)
ProGP959 (Transaldolase)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP960 (Putative thiamine biosynthesis oxidoreductase thiO)
ProGP961 (Threonine--tRNA ligase)
ProGP962 (Flavin-dependent thymidylate synthase)
ProGP963 (Trigger factor)
ProGP964 (tRNA(Ile)-lysidine synthase)
ProGP965 (Transketolase)
ProGP966 (TldD protein homolog)
ProGP967 (NADP-dependent malic enzyme)
ProGP968 (Outer membrane protein tolC)
ProGP969 (DNA topoisomerase 1)
ProGP97 (27kDa flagellin)
ProGP970 (Triosephosphate isomerase)
ProGP971 (VIRB9 protein)
ProGP972 (Thioredoxin reductase)
ProGP973 (Elongation factor Ts)
ProGP974 (GTP-binding protein TypA/BipA homolog)
ProGP975 (Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE)
ProGP976 (UvrABC system protein A)
ProGP977 (Hypothetical valine-tRNA ligase)
ProGP978 (VirB10 protein)
ProGP979 (VirD4 protein)
ProGP98 (32kDa flagellin)
ProGP980 (Ribosome-binding ATPase YchF)
ProGP981 (Membrane protein insertase YidC)
ProGP982 (Uncharacterized protein)
ProGP983 (Uncharacterized protein)
ProGP984 (Outer membrane protein assembly factor BamD)
ProGP985 (ATP-dependent Clp protease ATP-binding subunit clpA)
ProGP986 (Dihydroorotate dehydrogenase (quinone))
ProGP987 (Chromosomal replication initiator protein DnaA)
ProGP988 (Uncharacterized protein)
ProGP989 (Uncharacterized protein)
ProGP99 (PilE (pilin))
ProGP990 (Uncharacterized protein)
ProGP991 (Uncharacterized protein)
ProGP992 (Uncharacterized protein)
ProGP993 (Uncharacterized protein)
ProGP994 (Uncharacterized protein)
ProGP995 (Uncharacterized protein)
ProGP996 (Uncharacterized protein)
ProGP997 (Uncharacterized protein)
ProGP998 (Uncharacterized protein)
ProGP999 (Uncharacterized protein)
Compare ID
Choose Compare Id
ProGP1 (Envelope specific glycoprotein)
ProGP10 (Flagellin)
ProGP100 (PF sheath protein (44 kDa))
ProGP1000 (Uncharacterized protein)
ProGP1001 (VirB2 protein (homolog VirB2-8))
ProGP1002 (Uncharacterized protein)
ProGP1003 (Map1-related protein)
ProGP1004 (Map1-related protein)
ProGP1005 (Uncharacterized protein)
ProGP1006 (Enoyl-[acyl-carrier-protein] reductase [NADH])
ProGP1007 (Glyceraldehyde 3-phosphate dehydrogenase)
ProGP1008 (Chaperone protein hscA homolog)
ProGP1009 (Nucleoside diphosphate kinase)
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP1010 (Nitrogen assimilation regulatory protein NtrX)
ProGP1011 (Pyruvate dehydrogenase E1 component subunit alpha)
ProGP1012 (DNA polymerase I)
ProGP1013 (Phosphatidylserine decarboxylase proenzyme)
ProGP1014 (Probable ribonuclease D)
ProGP1015 (Putative Protease IV)
ProGP1016 (Phosphomethylpyrimidine synthase)
ProGP1017 (4-hydroxybenzoate octaprenyltransferase)
ProGP1018 (VIRB4 protein)
ProGP1019 (VirB8 protein)
ProGP102 (Flagellin B1)
ProGP1020 (Arginine--tRNA ligase)
ProGP1021 (Bacterioferritin comigratory protein)
ProGP1022 (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase)
ProGP1023 (Chaperone protein ClpB)
ProGP1024 (ATP-dependent Clp protease ATP-binding subunit ClpX)
ProGP1025 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
ProGP1026 (Enhancing lycopene biosynthesis protein 2)
ProGP1027 (Uncharacterized protein)
ProGP1028 (Uncharacterized protein)
ProGP1029 (Uncharacterized protein)
ProGP103 (Flagellin B2)
ProGP1030 (Uncharacterized protein)
ProGP1031 (Uncharacterized protein)
ProGP1032 (Uncharacterized protein)
ProGP1033 (Putative glutathione S-transferase)
ProGP1034 (Uncharacterized protein)
ProGP1035 (Uncharacterized protein)
ProGP1036 (Putative O-methyltransferase)
ProGP1037 (Probable transcriptional regulatory protein ERGA_CDS_03720)
ProGP1038 (Uncharacterized protein)
ProGP1039 (Uncharacterized protein)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP1040 (Uncharacterized protein)
ProGP1041 (Uncharacterized protein)
ProGP1042 (Hypothetical tRNA/rRNA methyltransferase)
ProGP1043 (Uncharacterized protein)
ProGP1044 (Uncharacterized protein)
ProGP1045 (Putative NADH-ubiquinone oxidoreductase subunit)
ProGP1046 (Map1-related protein)
ProGP1047 (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase)
ProGP1048 (Dihydropteroate synthase)
ProGP1049 (Possible major ferric iron binding protein)
ProGP105 (S-layer glycoprotein)
ProGP1050 (Glutamine synthetase I)
ProGP1051 (60 kDa chaperonin)
ProGP1052 (Glutaredoxin)
ProGP1053 (Ferrochelatase)
ProGP1054 (Integration host factor subunit alpha)
ProGP1055 (Possible geranyltranstransferase)
ProGP1056 (Maf-like protein EHRUM2_05950)
ProGP1057 (Malate dehydrogenase)
ProGP1058 (Quinolinate synthase A)
ProGP1059 (Nicotinate-nucleotide pyrophosphorylase)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP1060 (Multifunctional fusion protein)
ProGP1061 (NADH dehydrogenase I chain L)
ProGP1062 (Transcription termination/antitermination protein)
ProGP1063 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase)
ProGP1064 (Inorganic pyrophosphatase)
ProGP1065 (Peptide chain release factor 2)
ProGP1066 (Proline/betaine transporter)
ProGP1067 (Adenylosuccinate lyase)
ProGP1068 (Amidophosphoribosyltransferase)
ProGP1069 (Protein RecA)
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP1070 (3,4-dihydroxy-2-butanone 4-phosphate synthase)
ProGP1071 (50S ribosomal protein L13)
ProGP1072 (50S ribosomal protein L16)
ProGP1073 (DNA-directed RNA polymerase subunit alpha)
ProGP1074 (30S ribosomal protein S9)
ProGP1075 (30S ribosomal protein S19)
ProGP1076 (Protein-export protein SecB)
ProGP1077 (Protein-export membrane protein SecF)
ProGP1078 (Protein-export membrane protein SecF)
ProGP1079 (2-oxoglutarate dehydrogenase E1 component)
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP1080 (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex)
ProGP1081 (Succinyl-CoA synthetase subunit beta)
ProGP1082 (Succinyl-CoA ligase [ADP-forming] subunit alpha)
ProGP1083 (Ferredoxin--NADP reductase)
ProGP1084 (Putative Cold shock-like protein cspA)
ProGP1085 (Penicillin-binding protein dacF)
ProGP1086 (4-hydroxy-tetrahydrodipicolinate synthase)
ProGP1087 (Putative thiol:disulfide interchange protein dsbD)
ProGP1088 (Uncharacterized protein)
ProGP1089 (Uncharacterized protein)
ProGP109 (Stable protease)
ProGP1090 (Uncharacterized protein)
ProGP1091 (Uncharacterized protein)
ProGP1092 (Uncharacterized protein)
ProGP1093 (Uncharacterized protein)
ProGP1094 (Uncharacterized protein)
ProGP1095 (Uncharacterized protein)
ProGP1096 (Uncharacterized protein)
ProGP1097 (Uncharacterized protein)
ProGP1098 (Uncharacterized protein)
ProGP1099 (Uncharacterized protein)
ProGP11 (Autolysin (28 kDa))
ProGP110 (45 to 47-kDa protein)
ProGP1100 (Map1-related protein)
ProGP1101 (Uncharacterized protein)
ProGP1102 (Malonyl CoA-acyl carrier protein transacylase)
ProGP1103 (Dihydropteroate synthase)
ProGP1104 (Cell division protein FtsQ)
ProGP1105 (Citrate synthase)
ProGP1106 (Isocitrate dehydrogenase [NADP])
ProGP1107 (Outer membrane protein assembly factor BamA)
ProGP1108 (Peptidylprolyl isomerase)
ProGP1109 (Phosphate import ATP-binding protein PstB)
ProGP111 (S-layer glycoprotein)
ProGP1110 (N5-carboxyaminoimidazole ribonucleotide synthase)
ProGP1111 (Bifunctional protein PutA)
ProGP1112 (Ribose-5-phosphate isomerase)
ProGP1113 (50S ribosomal protein L19)
ProGP1114 (50S ribosomal protein L21)
ProGP1115 (50S ribosomal protein L22)
ProGP1116 (50S ribosomal protein L29)
ProGP1117 (RNA polymerase sigma factor RpoD)
ProGP1118 (Elongation factor Tu)
ProGP1119 (VirB11 protein)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP1120 (SCO3353)
ProGP1121 (SCO4307)
ProGP1122 (SCO2838)
ProGP1123 (SCO3046)
ProGP1124 (SCO4142)
ProGP1125 (SCO6558)
ProGP1126 (SCO3540)
ProGP1127 (SCO4141)
ProGP1128 (SCO5115)
ProGP1129 (SCO3357)
ProGP113 (Flagellin Laf1)
ProGP1130 (SCO4142)
ProGP1131 (SCO4968)
ProGP1132 (SCO5751)
ProGP1133 (SCO4256)
ProGP1134 (SCO5818)
ProGP1135 (SCO5776)
ProGP1136 (SCO0472)
ProGP1137 (SCO0996)
ProGP1138 (SCO1714)
ProGP1139 (SCO2035)
ProGP114 (Endo-β-N-acetylglucosaminidase F2)
ProGP1140 (SCO2096)
ProGP1141 (SCO2156)
ProGP1142 (SCO2963)
ProGP1143 (SCO3044)
ProGP1144 (SCO3046)
ProGP1145 (SCO3184)
ProGP1146 (SCO3357)
ProGP1147 (SCO3540)
ProGP1148 (SCO4130)
ProGP1149 (SCO4548)
ProGP115 (Flavastacin (P40))
ProGP1150 (SCO4739)
ProGP1151 (SCO4847)
ProGP1152 (SCO4885)
ProGP1153 (SCO4905)
ProGP1154 (SCO4934)
ProGP1155 (SCO5204)
ProGP1156 (SCO5646)
ProGP1157 (SCO5736)
ProGP1158 (SCO7218)
ProGP1159 (DsbA1 Protein)
ProGP116 (Endo-β-N-acetylglucosaminidase F3)
ProGP1160 (BCAL2640)
ProGP1161 (WTA-wall teichoic acid)
ProGP1162 (LTA- lipoteichoic acid)
ProGP1163 (Mpsy_1486)
ProGP1164 (DegP)
ProGP1165 (LspA)
ProGP1166 (SigA)
ProGP1167 (PstS1)
ProGP1168 (LprA)
ProGP1169 (LprF)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP1170 (DsbF)
ProGP1171 (Apa)
ProGP1172 (Wag31)
ProGP1173 (LppO)
ProGP1174 (Rv2799)
ProGP1175 (Mpt83)
ProGP1176 (LpqH)
ProGP1177 (EsxC)
ProGP1178 (DnaK)
ProGP1179 (OtsB1)
ProGP118 (Flagellin)
ProGP1180 (RplV)
ProGP1181 (DeaD)
ProGP1182 (InfC)
ProGP1183 (Pks5)
ProGP1184 (FadD28)
ProGP1185 (FhaA)
ProGP1186 (Rv0348)
ProGP1187 (DosT)
ProGP1188 (DesvR)
ProGP1189 (Icd2)
ProGP119 (Fimbrial protein (pilin))
ProGP1190 (Rv0216)
ProGP1191 (ThiD)
ProGP1192 (PnP)
ProGP1193 (MenH)
ProGP1194 (PurN)
ProGP1195 (PhoH2)
ProGP1196 (GlpX)
ProGP1197 (HtrA)
ProGP1198 (CarB)
ProGP1199 (GlnA1)
ProGP12 (12 kDa antigen)
ProGP120 (Protein A (cell wall glycoprotein))
ProGP1200 (AceE)
ProGP1201 (AroA)
ProGP1202 (SahH)
ProGP1203 (Rv3273)
ProGP1204 (Rv0311)
ProGP1205 (Rv0566c)
ProGP1206 (Rv1352)
ProGP1207 (Rv1466)
ProGP1208 (Rv2166c)
ProGP1209 (Rv2558)
ProGP121 (Surface layer glycoprotein Sat B)
ProGP1210 (Rv2826c)
ProGP1211 (Rv3491)
ProGP1212 (BCAL0114 (FliC))
ProGP1213 (BCAL0129 (CheA))
ProGP1214 (BCAL0524 (FliG))
ProGP1215 (BCAL0525 (FliF))
ProGP1216 (HuvA)
ProGP1217 (AidA)
ProGP1218 (SLP-5818)
ProGP1219 (SLP-5818)
ProGP122 (Surface layer glycoprotein SatA)
ProGP1220 (SLP-8321)
ProGP1221 (SLP-8348)
ProGP1222 (BTL2)
ProGP1223 (FlaB1)
ProGP1224 (FlaB2)
ProGP1225 (FlaB3)
ProGP1226 (FlaB4)
ProGP1227 (Fla A)
ProGP1228 (Acm2)
ProGP1229 (GkFlaA1)
ProGP123 (CRX (Copper response extracellular protein))
ProGP1230 (GkFlaA2)
ProGP1231 (CbFla)
ProGP1232 (Flagella)
ProGP1233 (SvC)
ProGP1234 (Conserved hypothetical protein)
ProGP1235 (DUF192 family protein)
ProGP1236 (Thermosome subunit 3)
ProGP1237 (ABC-type transport system periplasmic substrate-binding protein (probable substrate))
ProGP1238 (Pilin PilA)
ProGP1239 (Cox-type terminal oxidase subunit II)
ProGP124 (β-1,4-mannanase)
ProGP1240 (DUF4382 domain protein)
ProGP1241 (Conserved hypothetical protein)
ProGP1242 (Archaellin A1)
ProGP1243 (Archaellin A2)
ProGP1244 (Conserved hypothetical protein)
ProGP1245 (Dolichyl-monophosphooligosaccharide— protein glycotransferase AglB)
ProGP1246 (Conserved hypothetical protein)
ProGP1247 (Conserved hypothetical protein)
ProGP1248 (Conserved hypothetical protein)
ProGP1249 (Peptidase M10 family protein)
ProGP125 (Flagellin)
ProGP1250 (Conserved hypothetical protein)
ProGP1251 (M50 family metalloprotease)
ProGP1252 (Probable transmembrane glycoprotein/HTH domain protein)
ProGP1253 (Conserved hypothetical protein)
ProGP1254 (Protein-export membrane protein SecD)
ProGP1255 (GATase domain protein)
ProGP1256 (Pilin PilA)
ProGP1257 (Conserved hypothetical protein)
ProGP1258 (Conserved hypothetical protein)
ProGP1259 (Probable secreted glycoprotein)
ProGP126 (31/33 kDa flagellin)
ProGP1260 (SLG)
ProGP1261 (Probable secreted glycoprotein)
ProGP1262 (Probable secreted glycoprotein (nonfunctional))
ProGP1263 (Pectin lyase domain protein)
ProGP1264 (Conserved hypothetical protein)
ProGP1265 (ABC-type transport system permease protein (probable substrate macrolides))
ProGP1266 (Probable secreted glycoprotein)
ProGP1267 (Probable secreted glycoprotein)
ProGP1268 (Conserved hypothetical protein)
ProGP1269 (Conserved hypothetical protein)
ProGP127 (Flagellin B1 (41 kDa))
ProGP1270 (DUF1616 family protein)
ProGP1271 (Conserved hypothetical protein)
ProGP1272 (Conserved hypothetical protein)
ProGP1273 (Conserved hypothetical protein)
ProGP1274 (Conserved hypothetical protein)
ProGP1275 (Conserved hypothetical protein)
ProGP1276 (Conserved hypothetical protein)
ProGP1277 (LppX domain protein)
ProGP1278 (Hypothetical protein)
ProGP1279 (Conserved hypothetical protein)
ProGP128 (wmA (S-layer protein))
ProGP1280 (Probable transmembrane glycoprotein/HTH domain protein)
ProGP1281 (DNA-directed RNA polymerase subunit A’)
ProGP1282 (Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3)
ProGP1283 (50S ribosomal protein L43e)
ProGP1284 (Aspartate–tRNA(Asp/Asn) ligase)
ProGP1285 (Glutamate synthase (ferredoxin) large subunit)
ProGP1286 (30S ribosomal protein S15)
ProGP1287 (UspA domain protein)
ProGP1288 (Conserved hypothetical protein)
ProGP1289 (Probable phosphoribosyltransferase (homolog to anthranilate phosphoribosyltransferase))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP1290 (Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3)
ProGP1291 (Aspartate-semialdehyde dehydrogenase)
ProGP1292 (L-aspartate oxidase)
ProGP1293 (ABC-type transport system periplasmic substrate-binding protein (probable substrate dipeptide/oligopeptide))
ProGP1294 (ATP-dependent cobaltochelatase subunit CobN)
ProGP1295 (Pyruvate Kinase)
ProGP1296 (3-mthyl-2-oxobutanoate hydroxymethyl-transferase)
ProGP1297 (Pilin PilA)
ProGP1298 (Flagella)
ProGP1299 (S-layer glycoprotein (SlpA))
ProGP13 (33 kDa antigen)
ProGP130 (Pyrolysin)
ProGP1300 (FljK, Flagellin protein)
ProGP1301 (FljK, Flagellin protein)
ProGP1302 (NagC)
ProGP1303 (GlmR)
ProGP1304 (Hypothetical protein, CHU_2708)
ProGP1305 (Cel9A)
ProGP1306 (Pilin protein)
ProGP1307 (PilA)
ProGP1308 (AlpA/B)
ProGP1309 (BabA/B)
ProGP131 (Cell surface phosphatase)
ProGP1310 (SLP, S-layer protein)
ProGP1311 (Thread (Fourth filament))
ProGP1312 (PilE)
ProGP1313 (PilE)
ProGP1314(S-layer Protein, SLG)
ProGP132 (Chondroitinase-AC)
ProGP133 (Heparinase II)
ProGP134 (Exopolymer)
ProGP135 (37-kDa protein)
ProGP136 (Antigen (60 kDa))
ProGP137 (Oscillin (65.8 kDa))
ProGP138 (Cell surface glycoprotein)
ProGP139 (S-layer glycoprotein)
ProGP14 (Membrane glycoprotein)
ProGP140 (α-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP142 (Antifreeze protein)
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP145 (Adhesion inhibitor)
ProGP146 (Flagellin)
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP148 (β-1,4-mannanase (G-enzyme))
ProGP149 (Crystal toxin (66 kDa))
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP152 (Type A Flagellin)
ProGP153 (Flagellin)
ProGP154 (Flagellin)
ProGP155 (Flagellin)
ProGP156 (AnAF)
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP158 (FlaB (flagellar core protein))
ProGP159 (FlaB (flagellar core protein))
ProGP16 (50 kDa antigen)
ProGP160 (Flagellar filament 31.3 kDa core protein)
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP164 (FlaB (flagellar core protein))
ProGP165 (S-layer glycopeptide)
ProGP166 (Chondroitinase-B)
ProGP167 (BclA (collagen-like protein))
ProGP168 (Slp (S-layer glycoprotein))
ProGP169 (Surface layer glycoproteins)
ProGP17 (Flagellin)
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP172 (S-layer glycoprotein)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP174 (Flagellin A)
ProGP175 (Flagellin B)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP177 (HRgpA)
ProGP178 (mtRgpA)
ProGP179 (S-layer glycoprotein)
ProGP18 (S-layer glycoprotein SgsE)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP185 (Invertase)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP187 (flaA)
ProGP188 (flaB)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP190 (LppN lipoprotein)
ProGP191 (LppQ lipoprotein)
ProGP192 (LpqH)
ProGP193 (PstS1)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP196 (ComP)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP198 (Flagellin)
ProGP199 (Flagellin)
ProGP2 (Phytotoxin)
ProGP20 (Outer membrane protein (50 kDa))
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP205 (Flagellin A (FlaA))
ProGP206 (Flagellin (FlaA))
ProGP207 (Glycopeptidolipid (GPL))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP21 (Outer membrane protein (75 kDa))
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP213 (95-kDa glycoprotein)
ProGP214 (Flagellin B)
ProGP215 (Flagellin A (FlaA))
ProGP216 (BclA (collagen-like protein))
ProGP217 (AcrA or CmeA)
ProGP218 (CgpA)
ProGP219 (Cj0114)
ProGP22 (Flagellin FlaB1)
ProGP220 (Cj0200c)
ProGP221 (Cj1496c)
ProGP222 (PEB3)
ProGP223 (ZnuA)
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP227 (HMW1 (Adhesin))
ProGP228 (Short glycopeptides)
ProGP229 (GspB)
ProGP23 (Flagellin FlaB2)
ProGP230 (PilA (Type IV pilin))
ProGP231 (VirB10 protein)
ProGP232 (Flagellin FlaA)
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP234 (CipA (conserved hypothetical protein))
ProGP235 (CipB (putative dipeptide-binding protein
ProGP236 (HisJ)
ProGP237 (SgtA)
ProGP238 (FlaB1)
ProGP239 (FlaB2)
ProGP24 (Flagellin FlaB3)
ProGP240 (FlaB3)
ProGP241 (FlaA)
ProGP242 (S-layer protein)
ProGP243 (Synthetic Glycopeptide)
ProGP244 (SrpA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP248 (Flagellin B)
ProGP249 (Ag43 α (Antigen 43 passenger domain))
ProGP25 (33 and 34 kDa antigens)
ProGP250 (PilA (Pilin))
ProGP251 (Type b Flagellin)
ProGP252 (DgpA)
ProGP253 (DgpC)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP255 (HmcA)
ProGP256 (CmeC)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP258 (FlaB3)
ProGP259 (FlaB1)
ProGP26 (CenA (Endoglucanase A))
ProGP260 (FlaB2)
ProGP261 (Flagellin (FlaA))
ProGP262 (Pillin (Group IV))
ProGP263 (Rv3491)
ProGP264 (Glycosyl hydrolase)
ProGP265 (Rv2799)
ProGP266 (LprA)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP270 (BlaC)
ProGP271 (FecB)
ProGP272 (LppL)
ProGP273 (LppX (Putative lipoprotein))
ProGP274 (LppZ (Putative lipoprotein))
ProGP275 (LpqB lipoprotein)
ProGP276 (LpqF lipoprotein)
ProGP277 (LpqI)
ProGP278 (LpqN)
ProGP279 (LpqT (putative lipoprotein))
ProGP28 (Flagellin A1)
ProGP280 (LpqW (lipoprotein))
ProGP281 (LprF)
ProGP282 (prG)
ProGP283 (OppA)
ProGP284 (PonA2)
ProGP285 (PpiB)
ProGP286 (PstS2)
ProGP287 (PstS3)
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP29 (Flagellin A2)
ProGP290 (Rv0907)
ProGP291 (Rv0988)
ProGP292 (Rv1084)
ProGP293 (Rv2813)
ProGP294 (Secreted protease)
ProGP295 (Thioredoxin)
ProGP296 (FlaA (Flagellin))
ProGP297 (FlaB (Flagellin))
ProGP298 (FliC (Flagellin subunit))
ProGP299 (CcoP)
ProGP3 (S-layer glycoprotein)
ProGP30 (Flagellin B1)
ProGP300 (CycB)
ProGP301 (S-layer Protein)
ProGP302 (AniA)
ProGP303 (DsbA)
ProGP304 (Gna1946)
ProGP305 (Laz)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP307 (PotF)
ProGP308 (Sco)
ProGP309 (PstS (40 kDa))
ProGP31 (Flagellin B2)
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP313 (Hypothetical protein)
ProGP314 (Putative exported protein)
ProGP315 (Putative outer membrane protein)
ProGP316 (Srr1)
ProGP317 (BF3567)
ProGP318 (BF3918)
ProGP319 (BF0935)
ProGP32 (Flagellin B3)
ProGP320 (LppC)
ProGP321 (OmpA)
ProGP322 (EtpA Adhesin)
ProGP323 (JlpA (42-45 kDa antigen))
ProGP324 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP326 (FliC (Flagellin))
ProGP327 (LccA, an Archaeal Laccase)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP329 (FTH_1830)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP330 (FTH_0159)
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP334 (FTH_0311)
ProGP335 (FTH_1167)
ProGP336 (FTH_1761)
ProGP337 (FTH_1721)
ProGP338 (FTH_1293)
ProGP339 (FTH_0069)
ProGP34 (S-layer glycoprotein)
ProGP340 (FTH_1071)
ProGP341 (FTH_0414)
ProGP342 (FTH_0357)
ProGP343 (PilA (FTH_0384))
ProGP344 (SlaA (S-layer protein))
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP346 (Chondroitinase ABC)
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP348 (TfsB (S-layer protein))
ProGP349 (TF1259)
ProGP35 (β-1,4-Endoglucanases)
ProGP350 (TF2339)
ProGP351 (BF0810)
ProGP352 (Putative cell division protein)
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP357 (Putative lipoprotein)
ProGP358 (Putative membrane protein)
ProGP359 (Putative membrane protein)
ProGP36 (S-layer glycoprotein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP362 (Putative sulfatase family protein)
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP364 (Putative integral membrane protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP367 (Putative uncharacterized protein)
ProGP368 (Colicin V production protein)
ProGP369 (Putative membrane protein)
ProGP37 (S-layer glycoprotein)
ProGP370 (Putative exporting protein)
ProGP371 (Putative secreted protease)
ProGP372 (Putative periplasmic protein)
ProGP373 (Putative periplasmic protein)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP377 (Putative periplasmic protein)
ProGP378 (Putative membrane protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP38 (VGP (74 kDa))
ProGP380 (Putative periplasmic protein)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP382 (Putative secreted transglycosylase)
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP389 (Putative integral membrane protein)
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP390 (Putative sulfatase protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP392 (Putative periplasmic protein)
ProGP393 (Putative integral membrane protein)
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP399 (TfsA (S-layer protein))
ProGP4 (F-pilin)
ProGP40 (Long-fibril protein (LFP))
ProGP400 (Sublancin)
ProGP401 (Plantaricin ASM1)
ProGP402 (Glycocin F)
ProGP403 (FlaA (Flagellin))
ProGP404 (FlaB (Flagellin))
ProGP405 (TF0091)
ProGP406 (TF1056)
ProGP407 (EhaJ (autotranporter))
ProGP408 (FliC (Flagellin))
ProGP409 (FliC (Flagellin))
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP410 (DsbA)
ProGP411 (FTL_1096)
ProGP412 (OmpA/MotB)
ProGP413 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP416 (Putative Uncharacterized Protein)
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP42 (Cellobiosidase)
ProGP420 (FlaA (Polar flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP422 (LafA (Lateral flagellin))
ProGP423 (AniA)
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP425 (ABC Transporter (TreS))
ProGP426 (Oligopeptide binding protein)
ProGP427 (Hypothetical protein)
ProGP428 (Protease)
ProGP429 (Maltose ABC transporter)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP430 (Serine protease)
ProGP431 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP433 (Hypothetical protein)
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP435 (FasC (fasciclin domain protein))
ProGP436 (Acm2)
ProGP437 (FliC (Type B Flagellin))
ProGP438 (DnaK)
ProGP439 (Lp_2260)
ProGP44 (S-layer glycoprotein)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP442 (PdhC)
ProGP443 (FtsY)
ProGP444 (Lp_ 2793)
ProGP445 (FtsK1)
ProGP446 (Lp_3421)
ProGP447 (FtsZ)
ProGP448 (MOMP)
ProGP449 (PsrP (Adhesin))
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP450 (AtaC)
ProGP451 (COK_1394)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP454 (Rv1887)
ProGP455 (35kDa protein)
ProGP456 (Rv3835)
ProGP457 (LppO (Putative lipoprotein))
ProGP458 (ThuA)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP463 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP466 (Putative protein)
ProGP467 (Alanine and proline-rich secreted protein)
ProGP468 (C-terminal protease)
ProGP469 (MdtA multidrug resistance protein)
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP470 (Putative uncharacterized protein)
ProGP471 (Putative uncharacterized protein)
ProGP472 (Putative signal peptide)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP475 (Putative uncharacterized protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP477 (Putative cell division related protein)
ProGP478 (Putative uncharacterized protein)
ProGP479 (Putative lipoprotein)
ProGP48 (S-layer glycoprotein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP481 (CpxP-like protein)
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprotein)
ProGP484 (Putative exported protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP486 (Putative membrane protein)
ProGP487 (OM lipoprotein carrier LolA)
ProGP488 (OmlA)
ProGP489 (Cell division protein)
ProGP49 (S-layer glycoprotein)
ProGP490 (OmpA family protein)
ProGP491 (Putative uncharacterized protein)
ProGP492 (Type IV Pilin)
ProGP493 (CN)
ProGP494 (FliC (Flagellin))
ProGP495 (EF-P)
ProGP496 (PliA)
ProGP497 (Putative secretion protein)
ProGP498 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP5 (Factor PG-1)
ProGP50 (Flagellin A)
ProGP500 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP502 (Uncharacterized protein)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP506 (MetQ)
ProGP507 (Sco)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP509 (Ccop)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP510 (Translation elongation factor P (EF-P))
ProGP511 (Translation elongation factor P (EF-P))
ProGP512 (Enterocin F4-9)
ProGP513 (Knh)
ProGP514 (EmaA)
ProGP515 (NirK)
ProGP516 (C5)
ProGP517 (CcoP)
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP52 (Hypothetical protein)
ProGP520 (Hag flagellin)
ProGP521 (EF-P)
ProGP522 (Putative membrane fusion protein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP528 (FtsN)
ProGP529 (AcrA)
ProGP53 (33 kDa minor core flagellin)
ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrolase)
ProGP531 (Probable transmembrane protein)
ProGP532 (Probable serine protease protein)
ProGP533 (Probable m20-related peptidase)
ProGP534 (PilN)
ProGP535 (Probable lipoprotein)
ProGP536 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP538 (Probable transmembrane protein)
ProGP539 (PilA)
ProGP54 (34 kDa major core flagellin)
ProGP540 (Probable peptidase transmembrane protein)
ProGP541 (FtsL)
ProGP542 (Translation elongation factor P (EF-P))
ProGP543 (Flagellin A1)
ProGP544 (Flagellin A2)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP548 (Pilin A4)
ProGP549 (Pilin A6)
ProGP55 (Cell surface protein/S-layer protein)
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP553 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP555 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP557 (Hypothetical protein)
ProGP558 (ABC transporter substrate binding protei
ProGP559 (Pullulanase)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP560 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP562 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP564 (Hypothetical protein)
ProGP565 (Peptide binding protein)
ProGP566 (Multidrug RND transporter)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP57 (38 kDa antigen)
ProGP570 (Peptide transporter)
ProGP571 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP573 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP575 (Hypothetical protein)
ProGP576 (Penicillin amidase)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP578 (Cytochrome c biogenesis protein)
ProGP579 (Hypothetical protein)
ProGP58 (Thermopsin)
ProGP580 (Histidine kinase)
ProGP581 (Cytochrome c assembly)
ProGP582 (Metallophosphoesterase)
ProGP583 (ATP synthase subunit A)
ProGP584 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP586 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP59 (β-1, 4-D-glucosidase (51 kDa))
ProGP590 (Hypothetical protein)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP592 (Peptidase)
ProGP593 (Hypothetical protein)
ProGP594 (ABC transporter substrate binding protei
ProGP595 (Glycosyl transferase)
ProGP596 (Nitrate reductase beta subunit)
ProGP597 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP599 (Hypothetical protein)
ProGP6 (Cellulase CA)
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP600 (Hypothetical protein)
ProGP601 (Transglutaminase)
ProGP602 (FAD-dependent oxidoreductase)
ProGP603 (ABC transporter substrate binding protein)
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein)
ProGP606 (ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP609 (Hypothetical protein)
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP613 (Nitrous oxidase accessory protein)
ProGP614 (Glutamate dehydrogenase)
ProGP615 (Hypothetical protein)
ProGP616 (NADH dehydrogenase subunit D)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP618 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP62 (18 kDa and 32 kDa lectin binding proteins)
ProGP620 (Hypothetical protein)
ProGP621 (Sugar binding protein)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP623 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP625 (Hypothetical protein)
ProGP626 (Serpin)
ProGP627 (Hypothetical protein)
ProGP628 (ABC transporter substrate binding protein)
ProGP629 (ATPase)
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP630 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP634 (Peptide ABC transporter permease)
ProGP635 (TRAP ABC transporter)
ProGP636 (NosD)
ProGP637 (Cytochrome c biogenesis protein)
ProGP638 (Excisionase)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP640 (Primosomal protein)
ProGP641 (Hypothetical protein)
ProGP642 (Cytochrome c assembly protein)
ProGP643 (Glycosyltransferase)
ProGP644 (Hypothetical protein)
ProGP645 (ABC transporter substrate binding protein)
ProGP646 (Glycosyltransferase)
ProGP647 (Hypothetical protein)
ProGP648 (Nitrate reductase)
ProGP649 (Transcriptional regulator)
ProGP65 (24 kDa flagellin)
ProGP650 (Hypothetical protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP656 (RNA methyltransferase)
ProGP657 (Transcriptional regulator)
ProGP658 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP66 (25 kDa flagellin)
ProGP660 (Hypothetical protein)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP662 (30S ribosomal protein S2)
ProGP663 (Protein disulfide isomerase like protein)
ProGP664 (V-type ATPase subunit D)
ProGP665 (ABC transporter)
ProGP666 (ABC transporter)
ProGP667 (V-type ATP synthase subunit E)
ProGP668 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP67 (35 kDa flagellin)
ProGP670 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP672 (Hypothetical protein)
ProGP673 (FHA domain containing protein)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP678 (Hypothetical protein)
ProGP679 (Nitrate reductase alpha subunit)
ProGP68 (S-layer glycoprotein)
ProGP680 (Peptidase S8)
ProGP681 (Formate dehydrogenase)
ProGP682 (Flagellin)
ProGP683 (Flagellin)
ProGP684 (S-layer glycoprotein (pNG5138))
ProGP685 (Msp1)
ProGP686 (Ta0280)
ProGP687 (Ta1063)
ProGP688 (Ta1052)
ProGP689 (Ta0171)
ProGP69 (S-layer glycoprotein)
ProGP690 (Ta0261)
ProGP691 (Kustd1514)
ProGP692 (SpaCBA)
ProGP693 (Serine rich-repeat SrpA)
ProGP694 (Serine rich-repeat SrpB)
ProGP695 (Serine rich-repeat SrpC)
ProGP696 (WpaA)
ProGP697 (Cnm)
ProGP698 (HgpA)
ProGP699 (Cellulose A)
ProGP7 (Cellulase CB)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP700 (SlpA protein)
ProGP701 (hypothetical protein)
ProGP702 (hypothetical protein)
ProGP703 (Bacillicin CER074)
ProGP704 (Bacillicin BAG2O)
ProGP705 (Geocillicin)
ProGP706 (Listeriocytocin)
ProGP707 (CleA)
ProGP708 (WTA-wall teichoic acid)
ProGP709 (PalA)
ProGP71 (S-layer glycoprotein)
ProGP710 (Hyp1)
ProGP711 (Hyp2)
ProGP712 (Asm1)
ProGP713 (SRRP100-23)
ProGP714 (SRRP53608)
ProGP715 (LpqH)
ProGP716 (AcpM)
ProGP717 (Uncharacterized protein)
ProGP718 (Uncharacterized protein)
ProGP719 (Uncharacterized protein)
ProGP72 (Alkaline Phosphatase D)
ProGP720 (Aminotransferase)
ProGP721 (Aconitate hydratase)
ProGP722 (Acyl carrier protein)
ProGP723 (Adenylate kinase)
ProGP724 (Alanine--tRNA ligase)
ProGP725 (Alkaline protease secretion ATP-binding protein AprD)
ProGP726 (Alkaline protease secretion protein)
ProGP727 (N-acetyl-gamma-glutamyl-phosphate reductase)
ProGP728 (Ornithine carbamoyltransferase)
ProGP729 (Argininosuccinate synthase)
ProGP73 (p115/ PAAP)
ProGP730 (Argininosuccinate lyase)
ProGP731 (Arginine biosynthesis bifunctional protein ArgJ)
ProGP732 (Aspartate-semialdehyde dehydrogenase)
ProGP733 (Aspartate--tRNA(Asp/Asn) ligase)
ProGP734 (Putative ATP synthase epsilon chain 2)
ProGP735 (ATP synthase gamma chain)
ProGP736 (ATP synthase subunit delta)
ProGP737 (ATP synthase B chain)
ProGP738 (Carbamoyl-phosphate synthase small chain)
ProGP739 (Carbamoyl-phosphate synthase large chain)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP740 (ATP-dependent Clp protease proteolytic subunit)
ProGP741 (Cytochrome c oxidase subunit 2)
ProGP742 (Cytochrome c oxidase subunit 1)
ProGP743 (Cytochrome c homolog)
ProGP744 (Cysteine--tRNA ligase)
ProGP745 (4-hydroxy-tetrahydrodipicolinate reductase)
ProGP746 (Peptide deformylase)
ProGP747 (DNA/pantothenate metabolism flavoprotein homolog)
ProGP748 (Chaperone protein DnaJ)
ProGP749 (DNA polymerase III subunit beta)
ProGP75 (S-layer glycoprotein)
ProGP750 (DNA polymerase III subunit gamma/tau)
ProGP751 (Deoxyuridine 5'-triphosphate nucleotidohydrolase)
ProGP752 ((Dimethylallyl)adenosine tRNA methylthiotransferase)
ProGP753 (GTPase Der)
ProGP754 (Enolase)
ProGP755 (Hemolysin cluster)
ProGP756 (VirB8 protein)
ProGP757 (Uncharacterized protein)
ProGP758 (Uncharacterized protein)
ProGP759 (Uncharacterized protein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP760 (Uncharacterized protein)
ProGP761 (Uncharacterized protein)
ProGP762 (Uncharacterized protein)
ProGP763 (Uncharacterized protein)
ProGP764 (Uncharacterized protein)
ProGP765 (Uncharacterized protein)
ProGP766 (Uncharacterized protein)
ProGP767 (Uncharacterized protein)
ProGP768 (ABC transporter substrate binding protein)
ProGP769 (Uncharacterized protein)
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP770 (Uncharacterized protein)
ProGP771 (Uncharacterized protein)
ProGP772 (Uncharacterized protein)
ProGP773 (uncha/CBS/transporter associated domain protein)
ProGP774 (Histidine kinase PleC)
ProGP775 (Uncharacterized protein)
ProGP776 (Uncharacterized protein)
ProGP777 (Uncharacterized protein)
ProGP778 (Uncharacterized protein)
ProGP779 (Putative regulatory component of sensory transduction system PleD)
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP780 (Uncharacterized protein)
ProGP781 (Uncharacterized protein)
ProGP782 (Uncharacterized protein)
ProGP783 (Deoxyguanosinetriphosphate triphosphohydrolase-like protein)
ProGP784 (Probable sigma(54) modulation protein)
ProGP785 (Uncharacterized protein)
ProGP786 (Uncharacterized protein)
ProGP787 (Uncharacterized protein)
ProGP788 (Uncharacterized protein)
ProGP789 (Uncharacterized protein)
ProGP79 (S-layer glycoprotein)
ProGP790 (Uncharacterized protein)
ProGP791 (Probable aminoglycoside efflux pump (Acriflavine resistance protein D))
ProGP792 (Similar to human and bovine Cytochrome c1)
ProGP793 (Uncharacterized protein)
ProGP794 (Uncharacterized protein)
ProGP795 (VirB6 protein)
ProGP796 (VirB6 protein)
ProGP797 (VirB6 protein)
ProGP798 (VirB6 protein)
ProGP799 (Uncharacterized protein)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP800 (Uncharacterized protein)
ProGP801 (Uncharacterized protein)
ProGP802 (Uncharacterized protein)
ProGP803 (Carboxypeptidase 1)
ProGP804 (Uncharacterized protein)
ProGP805 (Uncharacterized protein)
ProGP806 (Uncharacterized protein)
ProGP807 (Uncharacterized protein)
ProGP808 (Fructose-1,6-bisphosphatase)
ProGP809 (Uncharacterized protein)
ProGP81 (S-layer glycoprotein)
ProGP810 (Uncharacterized protein)
ProGP811 (Uncharacterized protein)
ProGP812 (Uncharacterized protein)
ProGP813 (Uncharacterized protein)
ProGP814 (Uncharacterized protein)
ProGP815 (Uncharacterized protein)
ProGP816 (Hypothetical zinc protease)
ProGP817 (Uncharacterized protein)
ProGP818 (Uncharacterized protein)
ProGP819 (50S ribosomal protein L31)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP820 (Uncharacterized protein)
ProGP821 (Uncharacterized protein)
ProGP822 (Uncharacterized protein)
ProGP823 (Hypothetical zinc protease)
ProGP824 (Hypothetical zinc protease)
ProGP825 (Putative transferase)
ProGP826 (Zinc metalloprotease)
ProGP827 (Uncharacterized protein)
ProGP828 (Uncharacterized protein)
ProGP829 (Map1-related protein)
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP830 (Map1-related protein)
ProGP831 (3-oxoacyl-[acyl-carrier-protein] synthase 2)
ProGP832 (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ)
ProGP833 (Probable 3-hydroxyacyl-CoA dehydrogenase)
ProGP834 (Probable fructose-bisphosphate aldolase class I)
ProGP835 (Signal recognition particle protein)
ProGP836 (Methionyl-tRNA formyltransferase)
ProGP837 (Folylpolyglutamate synthase)
ProGP838 (Bifunctional protein FolD)
ProGP839 (Ribosome-recycling factor)
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP840 (Cell division protein ftsA)
ProGP841 (ATP-dependent zinc metalloprotease FtsH)
ProGP842 (DNA translocase ftsK)
ProGP843 (Signal recognition particle receptor FtsY)
ProGP844 (Cell division protein FtsZ)
ProGP845 (Fumarate hydratase class II)
ProGP846 (Fragment of Glutamyl-tRNA(Gln) amidotransferase subunit A (Duplication))
ProGP847 (Aspartyl/glutamyl-tRNA amidotransferase subunit B)
ProGP848 (Proton/sodium-glutamate symport protein)
ProGP849 (Glutamate--tRNA ligase)
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP850 (Glutamate--tRNA ligase 1)
ProGP851 (Glycine--tRNA ligase alpha subunit)
ProGP852 (Glycine--tRNA ligase beta subunit)
ProGP853 (2,3-bisphosphoglycerate-independent phosphoglycerate mutase)
ProGP854 (Glycerol-3-phosphate dehydrogenase [NAD(P)+])
ProGP855 (Transcription elongation factor)
ProGP856 (Glutaredoxin)
ProGP857 (GMP synthase [glutamine-hydrolyzing])
ProGP858 (Inosine-5'-monophosphate dehydrogenase)
ProGP859 (DNA gyrase subunit A)
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP860 (5-aminolevulinate synthase)
ProGP861 (Delta-aminolevulinic acid dehydratase)
ProGP862 (Coproporphyrinogen oxidase)
ProGP863 (Protein HflC)
ProGP864 (Protease activity modulator hflk)
ProGP865 (Histidine--tRNA ligase)
ProGP866 (ATP-dependent protease ATPase subunit HslU)
ProGP867 (ATP-dependent protease subunit HslV)
ProGP868 (Chaperone protein HtpG)
ProGP869 (Isoleucine--tRNA ligase)
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP870 (Translation initiation factor IF-1)
ProGP871 (Translation initiation factor IF-2)
ProGP872 (Translation initiation factor IF-3)
ProGP873 (Cysteine desulfurase IscS)
ProGP874 (Octaprenyl-diphosphate synthase)
ProGP875 (4-diphosphocytidyl-2-C-methyl-D-erythritol kinase)
ProGP876 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin))
ProGP877 (Glutathione-regulated potassium-efflux system protein)
ProGP878 (Elongation factor 4)
ProGP879 (Signal peptidase I)
ProGP88 (S-layer glycoprotein)
ProGP880 (Leucine--tRNA ligase)
ProGP881 (Apolipoprotein N-acyltransferase)
ProGP882 (Lon protease)
ProGP883 (Dihydrolipoyl dehydrogenase)
ProGP884 (Diaminopimelate decarboxylase)
ProGP885 (Aspartokinase)
ProGP886 (Lysine--tRNA ligase)
ProGP887 (Methionine aminopeptidase)
ProGP888 (Major antigenic protein 1)
ProGP889 (Methionine--tRNA ligase)
ProGP89 (Surface layer glycoprotein)
ProGP890 (Putative ribonucleotide transport ATP-binding protein )
ProGP891 (Lipid A export ATP-binding protein)
ProGP892 (DNA mismatch repair protein)
ProGP893 (DNA mismatch repair protein MutS)
ProGP894 (Iron-sulfur cluster assembly scaffold protein IscU)
ProGP895 (Similar to lipoprotein nlpD)
ProGP896 (Ribonucleoside-diphosphate reductase)
ProGP897 (Ribonucleoside-diphosphate reductase subunit beta)
ProGP898 (NADH-quinone oxidoreductase subunit C)
ProGP899 (NADH-quinone oxidoreductase subunit D)
ProGP9 (8 kDa fimbrae)
ProGP90 (Antigens)
ProGP900 (NADH-quinone oxidoreductase subunit F)
ProGP901 (NADH-quinone oxidoreductase chain G)
ProGP902 (NADH-quinone oxidoreductase subunit H)
ProGP903 (Transcription termination/antitermination protein NusA)
ProGP904 (Probable chromosome partitioning protein parB)
ProGP905 (Propionyl-CoA carboxylase alpha chain)
ProGP906 (Propionyl-CoA carboxylase beta chain)
ProGP907 (Pyruvate dehydrogenase E1 component, beta subunit)
ProGP908 (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
ProGP909 (Ubiquinol-cytochrome c reductase iron-sulfur subunit)
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP910 (Cytochrome b)
ProGP911 (Phosphoglycerate kinase)
ProGP912 (Phenylalanine--tRNA ligase alpha subunit)
ProGP913 (Phenylalanine--tRNA ligase beta subunit)
ProGP914 (Phosphoribosyl 1,2-cyclic phosphate phosphodiesterase)
ProGP915 (Possible 1-acyl-sn-glycerol-3-phosphate acyltransferase)
ProGP916 (Phosphate acyltransferase)
ProGP917 (PmbA protein homolog)
ProGP918 (Pyruvate, phosphate dikinase)
ProGP919 (Peptide chain release factor 1)
ProGP92 (Anitigen (1000 kDa protein))
ProGP920 (Pyrroline-5-carboxylate reductase)
ProGP921 (Proline/betaine transporter)
ProGP922 (Proline--tRNA ligase)
ProGP923 (Ribose-phosphate pyrophosphokinase)
ProGP924 (Adenylosuccinate synthetase)
ProGP925 (Phosphoribosylformylglycinamidine synthase subunit PurL)
ProGP926 (Phosphoribosylformylglycinamidine cyclo-ligase)
ProGP927 (Phosphoribosylglycinamide formyltransferase)
ProGP928 (Orotidine 5'-phosphate decarboxylase)
ProGP929 (CTP synthase)
ProGP93 (Protein complex)
ProGP930 (Uridylate kinase)
ProGP931 (Quinone oxidoreductase)
ProGP932 (DNA replication and repair protein RecF)
ProGP933 (Transcription termination factor Rho)
ProGP934 (6,7-dimethyl-8-ribityllumazine synthase)
ProGP935 (Ribonuclease E)
ProGP936 (50S ribosomal protein L1)
ProGP937 (50S ribosomal protein L6)
ProGP938 (50S ribosomal protein L9)
ProGP939 (50S ribosomal protein L18)
ProGP94 (Surface layer glycoprotein)
ProGP940 (50S ribosomal protein L25)
ProGP941 (DNA-directed RNA polymerase subunit omega)
ProGP942 (30S ribosomal protein S1)
ProGP943 (30S ribosomal protein S4)
ProGP944 (30S ribosomal protein S7)
ProGP945 (30S ribosomal protein S8)
ProGP946 (30S ribosomal protein S10)
ProGP947 (30S ribosomal protein S16)
ProGP948 (30S ribosomal protein S20)
ProGP949 (30S ribosomal protein S21)
ProGP95 (S-layer glycoprotein)
ProGP950 (Succinate dehydrogenase flavoprotein subunit)
ProGP951 (Succinate dehydrogenase iron-sulfur subunit)
ProGP952 (Protein translocase subunit SecA)
ProGP953 (Protein translocase subunit SecD)
ProGP954 (Protein translocase subunit SecY)
ProGP955 (Serine--tRNA ligase)
ProGP956 (Uncharacterized protein)
ProGP957 (Single-stranded DNA-binding protein)
ProGP958 (Inositol-1-monophosphatase)
ProGP959 (Transaldolase)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP960 (Putative thiamine biosynthesis oxidoreductase thiO)
ProGP961 (Threonine--tRNA ligase)
ProGP962 (Flavin-dependent thymidylate synthase)
ProGP963 (Trigger factor)
ProGP964 (tRNA(Ile)-lysidine synthase)
ProGP965 (Transketolase)
ProGP966 (TldD protein homolog)
ProGP967 (NADP-dependent malic enzyme)
ProGP968 (Outer membrane protein tolC)
ProGP969 (DNA topoisomerase 1)
ProGP97 (27kDa flagellin)
ProGP970 (Triosephosphate isomerase)
ProGP971 (VIRB9 protein)
ProGP972 (Thioredoxin reductase)
ProGP973 (Elongation factor Ts)
ProGP974 (GTP-binding protein TypA/BipA homolog)
ProGP975 (Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE)
ProGP976 (UvrABC system protein A)
ProGP977 (Hypothetical valine-tRNA ligase)
ProGP978 (VirB10 protein)
ProGP979 (VirD4 protein)
ProGP98 (32kDa flagellin)
ProGP980 (Ribosome-binding ATPase YchF)
ProGP981 (Membrane protein insertase YidC)
ProGP982 (Uncharacterized protein)
ProGP983 (Uncharacterized protein)
ProGP984 (Outer membrane protein assembly factor BamD)
ProGP985 (ATP-dependent Clp protease ATP-binding subunit clpA)
ProGP986 (Dihydroorotate dehydrogenase (quinone))
ProGP987 (Chromosomal replication initiator protein DnaA)
ProGP988 (Uncharacterized protein)
ProGP989 (Uncharacterized protein)
ProGP99 (PilE (pilin))
ProGP990 (Uncharacterized protein)
ProGP991 (Uncharacterized protein)
ProGP992 (Uncharacterized protein)
ProGP993 (Uncharacterized protein)
ProGP994 (Uncharacterized protein)
ProGP995 (Uncharacterized protein)
ProGP996 (Uncharacterized protein)
ProGP997 (Uncharacterized protein)
ProGP998 (Uncharacterized protein)
ProGP999 (Uncharacterized protein)
Compare ID
Choose Compare Id
ProGP1 (Envelope specific glycoprotein)
ProGP10 (Flagellin)
ProGP100 (PF sheath protein (44 kDa))
ProGP1000 (Uncharacterized protein)
ProGP1001 (VirB2 protein (homolog VirB2-8))
ProGP1002 (Uncharacterized protein)
ProGP1003 (Map1-related protein)
ProGP1004 (Map1-related protein)
ProGP1005 (Uncharacterized protein)
ProGP1006 (Enoyl-[acyl-carrier-protein] reductase [NADH])
ProGP1007 (Glyceraldehyde 3-phosphate dehydrogenase)
ProGP1008 (Chaperone protein hscA homolog)
ProGP1009 (Nucleoside diphosphate kinase)
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP1010 (Nitrogen assimilation regulatory protein NtrX)
ProGP1011 (Pyruvate dehydrogenase E1 component subunit alpha)
ProGP1012 (DNA polymerase I)
ProGP1013 (Phosphatidylserine decarboxylase proenzyme)
ProGP1014 (Probable ribonuclease D)
ProGP1015 (Putative Protease IV)
ProGP1016 (Phosphomethylpyrimidine synthase)
ProGP1017 (4-hydroxybenzoate octaprenyltransferase)
ProGP1018 (VIRB4 protein)
ProGP1019 (VirB8 protein)
ProGP102 (Flagellin B1)
ProGP1020 (Arginine--tRNA ligase)
ProGP1021 (Bacterioferritin comigratory protein)
ProGP1022 (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase)
ProGP1023 (Chaperone protein ClpB)
ProGP1024 (ATP-dependent Clp protease ATP-binding subunit ClpX)
ProGP1025 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
ProGP1026 (Enhancing lycopene biosynthesis protein 2)
ProGP1027 (Uncharacterized protein)
ProGP1028 (Uncharacterized protein)
ProGP1029 (Uncharacterized protein)
ProGP103 (Flagellin B2)
ProGP1030 (Uncharacterized protein)
ProGP1031 (Uncharacterized protein)
ProGP1032 (Uncharacterized protein)
ProGP1033 (Putative glutathione S-transferase)
ProGP1034 (Uncharacterized protein)
ProGP1035 (Uncharacterized protein)
ProGP1036 (Putative O-methyltransferase)
ProGP1037 (Probable transcriptional regulatory protein ERGA_CDS_03720)
ProGP1038 (Uncharacterized protein)
ProGP1039 (Uncharacterized protein)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP1040 (Uncharacterized protein)
ProGP1041 (Uncharacterized protein)
ProGP1042 (Hypothetical tRNA/rRNA methyltransferase)
ProGP1043 (Uncharacterized protein)
ProGP1044 (Uncharacterized protein)
ProGP1045 (Putative NADH-ubiquinone oxidoreductase subunit)
ProGP1046 (Map1-related protein)
ProGP1047 (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase)
ProGP1048 (Dihydropteroate synthase)
ProGP1049 (Possible major ferric iron binding protein)
ProGP105 (S-layer glycoprotein)
ProGP1050 (Glutamine synthetase I)
ProGP1051 (60 kDa chaperonin)
ProGP1052 (Glutaredoxin)
ProGP1053 (Ferrochelatase)
ProGP1054 (Integration host factor subunit alpha)
ProGP1055 (Possible geranyltranstransferase)
ProGP1056 (Maf-like protein EHRUM2_05950)
ProGP1057 (Malate dehydrogenase)
ProGP1058 (Quinolinate synthase A)
ProGP1059 (Nicotinate-nucleotide pyrophosphorylase)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP1060 (Multifunctional fusion protein)
ProGP1061 (NADH dehydrogenase I chain L)
ProGP1062 (Transcription termination/antitermination protein)
ProGP1063 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase)
ProGP1064 (Inorganic pyrophosphatase)
ProGP1065 (Peptide chain release factor 2)
ProGP1066 (Proline/betaine transporter)
ProGP1067 (Adenylosuccinate lyase)
ProGP1068 (Amidophosphoribosyltransferase)
ProGP1069 (Protein RecA)
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP1070 (3,4-dihydroxy-2-butanone 4-phosphate synthase)
ProGP1071 (50S ribosomal protein L13)
ProGP1072 (50S ribosomal protein L16)
ProGP1073 (DNA-directed RNA polymerase subunit alpha)
ProGP1074 (30S ribosomal protein S9)
ProGP1075 (30S ribosomal protein S19)
ProGP1076 (Protein-export protein SecB)
ProGP1077 (Protein-export membrane protein SecF)
ProGP1078 (Protein-export membrane protein SecF)
ProGP1079 (2-oxoglutarate dehydrogenase E1 component)
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP1080 (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex)
ProGP1081 (Succinyl-CoA synthetase subunit beta)
ProGP1082 (Succinyl-CoA ligase [ADP-forming] subunit alpha)
ProGP1083 (Ferredoxin--NADP reductase)
ProGP1084 (Putative Cold shock-like protein cspA)
ProGP1085 (Penicillin-binding protein dacF)
ProGP1086 (4-hydroxy-tetrahydrodipicolinate synthase)
ProGP1087 (Putative thiol:disulfide interchange protein dsbD)
ProGP1088 (Uncharacterized protein)
ProGP1089 (Uncharacterized protein)
ProGP109 (Stable protease)
ProGP1090 (Uncharacterized protein)
ProGP1091 (Uncharacterized protein)
ProGP1092 (Uncharacterized protein)
ProGP1093 (Uncharacterized protein)
ProGP1094 (Uncharacterized protein)
ProGP1095 (Uncharacterized protein)
ProGP1096 (Uncharacterized protein)
ProGP1097 (Uncharacterized protein)
ProGP1098 (Uncharacterized protein)
ProGP1099 (Uncharacterized protein)
ProGP11 (Autolysin (28 kDa))
ProGP110 (45 to 47-kDa protein)
ProGP1100 (Map1-related protein)
ProGP1101 (Uncharacterized protein)
ProGP1102 (Malonyl CoA-acyl carrier protein transacylase)
ProGP1103 (Dihydropteroate synthase)
ProGP1104 (Cell division protein FtsQ)
ProGP1105 (Citrate synthase)
ProGP1106 (Isocitrate dehydrogenase [NADP])
ProGP1107 (Outer membrane protein assembly factor BamA)
ProGP1108 (Peptidylprolyl isomerase)
ProGP1109 (Phosphate import ATP-binding protein PstB)
ProGP111 (S-layer glycoprotein)
ProGP1110 (N5-carboxyaminoimidazole ribonucleotide synthase)
ProGP1111 (Bifunctional protein PutA)
ProGP1112 (Ribose-5-phosphate isomerase)
ProGP1113 (50S ribosomal protein L19)
ProGP1114 (50S ribosomal protein L21)
ProGP1115 (50S ribosomal protein L22)
ProGP1116 (50S ribosomal protein L29)
ProGP1117 (RNA polymerase sigma factor RpoD)
ProGP1118 (Elongation factor Tu)
ProGP1119 (VirB11 protein)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP1120 (SCO3353)
ProGP1121 (SCO4307)
ProGP1122 (SCO2838)
ProGP1123 (SCO3046)
ProGP1124 (SCO4142)
ProGP1125 (SCO6558)
ProGP1126 (SCO3540)
ProGP1127 (SCO4141)
ProGP1128 (SCO5115)
ProGP1129 (SCO3357)
ProGP113 (Flagellin Laf1)
ProGP1130 (SCO4142)
ProGP1131 (SCO4968)
ProGP1132 (SCO5751)
ProGP1133 (SCO4256)
ProGP1134 (SCO5818)
ProGP1135 (SCO5776)
ProGP1136 (SCO0472)
ProGP1137 (SCO0996)
ProGP1138 (SCO1714)
ProGP1139 (SCO2035)
ProGP114 (Endo-β-N-acetylglucosaminidase F2)
ProGP1140 (SCO2096)
ProGP1141 (SCO2156)
ProGP1142 (SCO2963)
ProGP1143 (SCO3044)
ProGP1144 (SCO3046)
ProGP1145 (SCO3184)
ProGP1146 (SCO3357)
ProGP1147 (SCO3540)
ProGP1148 (SCO4130)
ProGP1149 (SCO4548)
ProGP115 (Flavastacin (P40))
ProGP1150 (SCO4739)
ProGP1151 (SCO4847)
ProGP1152 (SCO4885)
ProGP1153 (SCO4905)
ProGP1154 (SCO4934)
ProGP1155 (SCO5204)
ProGP1156 (SCO5646)
ProGP1157 (SCO5736)
ProGP1158 (SCO7218)
ProGP1159 (DsbA1 Protein)
ProGP116 (Endo-β-N-acetylglucosaminidase F3)
ProGP1160 (BCAL2640)
ProGP1161 (WTA-wall teichoic acid)
ProGP1162 (LTA- lipoteichoic acid)
ProGP1163 (Mpsy_1486)
ProGP1164 (DegP)
ProGP1165 (LspA)
ProGP1166 (SigA)
ProGP1167 (PstS1)
ProGP1168 (LprA)
ProGP1169 (LprF)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP1170 (DsbF)
ProGP1171 (Apa)
ProGP1172 (Wag31)
ProGP1173 (LppO)
ProGP1174 (Rv2799)
ProGP1175 (Mpt83)
ProGP1176 (LpqH)
ProGP1177 (EsxC)
ProGP1178 (DnaK)
ProGP1179 (OtsB1)
ProGP118 (Flagellin)
ProGP1180 (RplV)
ProGP1181 (DeaD)
ProGP1182 (InfC)
ProGP1183 (Pks5)
ProGP1184 (FadD28)
ProGP1185 (FhaA)
ProGP1186 (Rv0348)
ProGP1187 (DosT)
ProGP1188 (DesvR)
ProGP1189 (Icd2)
ProGP119 (Fimbrial protein (pilin))
ProGP1190 (Rv0216)
ProGP1191 (ThiD)
ProGP1192 (PnP)
ProGP1193 (MenH)
ProGP1194 (PurN)
ProGP1195 (PhoH2)
ProGP1196 (GlpX)
ProGP1197 (HtrA)
ProGP1198 (CarB)
ProGP1199 (GlnA1)
ProGP12 (12 kDa antigen)
ProGP120 (Protein A (cell wall glycoprotein))
ProGP1200 (AceE)
ProGP1201 (AroA)
ProGP1202 (SahH)
ProGP1203 (Rv3273)
ProGP1204 (Rv0311)
ProGP1205 (Rv0566c)
ProGP1206 (Rv1352)
ProGP1207 (Rv1466)
ProGP1208 (Rv2166c)
ProGP1209 (Rv2558)
ProGP121 (Surface layer glycoprotein Sat B)
ProGP1210 (Rv2826c)
ProGP1211 (Rv3491)
ProGP1212 (BCAL0114 (FliC))
ProGP1213 (BCAL0129 (CheA))
ProGP1214 (BCAL0524 (FliG))
ProGP1215 (BCAL0525 (FliF))
ProGP1216 (HuvA)
ProGP1217 (AidA)
ProGP1218 (SLP-5818)
ProGP1219 (SLP-5818)
ProGP122 (Surface layer glycoprotein SatA)
ProGP1220 (SLP-8321)
ProGP1221 (SLP-8348)
ProGP1222 (BTL2)
ProGP1223 (FlaB1)
ProGP1224 (FlaB2)
ProGP1225 (FlaB3)
ProGP1226 (FlaB4)
ProGP1227 (Fla A)
ProGP1228 (Acm2)
ProGP1229 (GkFlaA1)
ProGP123 (CRX (Copper response extracellular protein))
ProGP1230 (GkFlaA2)
ProGP1231 (CbFla)
ProGP1232 (Flagella)
ProGP1233 (SvC)
ProGP1234 (Conserved hypothetical protein)
ProGP1235 (DUF192 family protein)
ProGP1236 (Thermosome subunit 3)
ProGP1237 (ABC-type transport system periplasmic substrate-binding protein (probable substrate))
ProGP1238 (Pilin PilA)
ProGP1239 (Cox-type terminal oxidase subunit II)
ProGP124 (β-1,4-mannanase)
ProGP1240 (DUF4382 domain protein)
ProGP1241 (Conserved hypothetical protein)
ProGP1242 (Archaellin A1)
ProGP1243 (Archaellin A2)
ProGP1244 (Conserved hypothetical protein)
ProGP1245 (Dolichyl-monophosphooligosaccharide— protein glycotransferase AglB)
ProGP1246 (Conserved hypothetical protein)
ProGP1247 (Conserved hypothetical protein)
ProGP1248 (Conserved hypothetical protein)
ProGP1249 (Peptidase M10 family protein)
ProGP125 (Flagellin)
ProGP1250 (Conserved hypothetical protein)
ProGP1251 (M50 family metalloprotease)
ProGP1252 (Probable transmembrane glycoprotein/HTH domain protein)
ProGP1253 (Conserved hypothetical protein)
ProGP1254 (Protein-export membrane protein SecD)
ProGP1255 (GATase domain protein)
ProGP1256 (Pilin PilA)
ProGP1257 (Conserved hypothetical protein)
ProGP1258 (Conserved hypothetical protein)
ProGP1259 (Probable secreted glycoprotein)
ProGP126 (31/33 kDa flagellin)
ProGP1260 (SLG)
ProGP1261 (Probable secreted glycoprotein)
ProGP1262 (Probable secreted glycoprotein (nonfunctional))
ProGP1263 (Pectin lyase domain protein)
ProGP1264 (Conserved hypothetical protein)
ProGP1265 (ABC-type transport system permease protein (probable substrate macrolides))
ProGP1266 (Probable secreted glycoprotein)
ProGP1267 (Probable secreted glycoprotein)
ProGP1268 (Conserved hypothetical protein)
ProGP1269 (Conserved hypothetical protein)
ProGP127 (Flagellin B1 (41 kDa))
ProGP1270 (DUF1616 family protein)
ProGP1271 (Conserved hypothetical protein)
ProGP1272 (Conserved hypothetical protein)
ProGP1273 (Conserved hypothetical protein)
ProGP1274 (Conserved hypothetical protein)
ProGP1275 (Conserved hypothetical protein)
ProGP1276 (Conserved hypothetical protein)
ProGP1277 (LppX domain protein)
ProGP1278 (Hypothetical protein)
ProGP1279 (Conserved hypothetical protein)
ProGP128 (wmA (S-layer protein))
ProGP1280 (Probable transmembrane glycoprotein/HTH domain protein)
ProGP1281 (DNA-directed RNA polymerase subunit A’)
ProGP1282 (Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3)
ProGP1283 (50S ribosomal protein L43e)
ProGP1284 (Aspartate–tRNA(Asp/Asn) ligase)
ProGP1285 (Glutamate synthase (ferredoxin) large subunit)
ProGP1286 (30S ribosomal protein S15)
ProGP1287 (UspA domain protein)
ProGP1288 (Conserved hypothetical protein)
ProGP1289 (Probable phosphoribosyltransferase (homolog to anthranilate phosphoribosyltransferase))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP1290 (Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3)
ProGP1291 (Aspartate-semialdehyde dehydrogenase)
ProGP1292 (L-aspartate oxidase)
ProGP1293 (ABC-type transport system periplasmic substrate-binding protein (probable substrate dipeptide/oligopeptide))
ProGP1294 (ATP-dependent cobaltochelatase subunit CobN)
ProGP1295 (Pyruvate Kinase)
ProGP1296 (3-mthyl-2-oxobutanoate hydroxymethyl-transferase)
ProGP1297 (Pilin PilA)
ProGP1298 (Flagella)
ProGP1299 (S-layer glycoprotein (SlpA))
ProGP13 (33 kDa antigen)
ProGP130 (Pyrolysin)
ProGP1300 (FljK, Flagellin protein)
ProGP1301 (FljK, Flagellin protein)
ProGP1302 (NagC)
ProGP1303 (GlmR)
ProGP1304 (Hypothetical protein, CHU_2708)
ProGP1305 (Cel9A)
ProGP1306 (Pilin protein)
ProGP1307 (PilA)
ProGP1308 (AlpA/B)
ProGP1309 (BabA/B)
ProGP131 (Cell surface phosphatase)
ProGP1310 (SLP, S-layer protein)
ProGP1311 (Thread (Fourth filament))
ProGP1312 (PilE)
ProGP1313 (PilE)
ProGP1314(S-layer Protein, SLG)
ProGP132 (Chondroitinase-AC)
ProGP133 (Heparinase II)
ProGP134 (Exopolymer)
ProGP135 (37-kDa protein)
ProGP136 (Antigen (60 kDa))
ProGP137 (Oscillin (65.8 kDa))
ProGP138 (Cell surface glycoprotein)
ProGP139 (S-layer glycoprotein)
ProGP14 (Membrane glycoprotein)
ProGP140 (α-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP142 (Antifreeze protein)
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP145 (Adhesion inhibitor)
ProGP146 (Flagellin)
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP148 (β-1,4-mannanase (G-enzyme))
ProGP149 (Crystal toxin (66 kDa))
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP152 (Type A Flagellin)
ProGP153 (Flagellin)
ProGP154 (Flagellin)
ProGP155 (Flagellin)
ProGP156 (AnAF)
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP158 (FlaB (flagellar core protein))
ProGP159 (FlaB (flagellar core protein))
ProGP16 (50 kDa antigen)
ProGP160 (Flagellar filament 31.3 kDa core protein)
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP164 (FlaB (flagellar core protein))
ProGP165 (S-layer glycopeptide)
ProGP166 (Chondroitinase-B)
ProGP167 (BclA (collagen-like protein))
ProGP168 (Slp (S-layer glycoprotein))
ProGP169 (Surface layer glycoproteins)
ProGP17 (Flagellin)
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP172 (S-layer glycoprotein)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP174 (Flagellin A)
ProGP175 (Flagellin B)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP177 (HRgpA)
ProGP178 (mtRgpA)
ProGP179 (S-layer glycoprotein)
ProGP18 (S-layer glycoprotein SgsE)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP185 (Invertase)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP187 (flaA)
ProGP188 (flaB)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP190 (LppN lipoprotein)
ProGP191 (LppQ lipoprotein)
ProGP192 (LpqH)
ProGP193 (PstS1)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP196 (ComP)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP198 (Flagellin)
ProGP199 (Flagellin)
ProGP2 (Phytotoxin)
ProGP20 (Outer membrane protein (50 kDa))
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP205 (Flagellin A (FlaA))
ProGP206 (Flagellin (FlaA))
ProGP207 (Glycopeptidolipid (GPL))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP21 (Outer membrane protein (75 kDa))
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP213 (95-kDa glycoprotein)
ProGP214 (Flagellin B)
ProGP215 (Flagellin A (FlaA))
ProGP216 (BclA (collagen-like protein))
ProGP217 (AcrA or CmeA)
ProGP218 (CgpA)
ProGP219 (Cj0114)
ProGP22 (Flagellin FlaB1)
ProGP220 (Cj0200c)
ProGP221 (Cj1496c)
ProGP222 (PEB3)
ProGP223 (ZnuA)
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP227 (HMW1 (Adhesin))
ProGP228 (Short glycopeptides)
ProGP229 (GspB)
ProGP23 (Flagellin FlaB2)
ProGP230 (PilA (Type IV pilin))
ProGP231 (VirB10 protein)
ProGP232 (Flagellin FlaA)
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP234 (CipA (conserved hypothetical protein))
ProGP235 (CipB (putative dipeptide-binding protein
ProGP236 (HisJ)
ProGP237 (SgtA)
ProGP238 (FlaB1)
ProGP239 (FlaB2)
ProGP24 (Flagellin FlaB3)
ProGP240 (FlaB3)
ProGP241 (FlaA)
ProGP242 (S-layer protein)
ProGP243 (Synthetic Glycopeptide)
ProGP244 (SrpA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP248 (Flagellin B)
ProGP249 (Ag43 α (Antigen 43 passenger domain))
ProGP25 (33 and 34 kDa antigens)
ProGP250 (PilA (Pilin))
ProGP251 (Type b Flagellin)
ProGP252 (DgpA)
ProGP253 (DgpC)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP255 (HmcA)
ProGP256 (CmeC)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP258 (FlaB3)
ProGP259 (FlaB1)
ProGP26 (CenA (Endoglucanase A))
ProGP260 (FlaB2)
ProGP261 (Flagellin (FlaA))
ProGP262 (Pillin (Group IV))
ProGP263 (Rv3491)
ProGP264 (Glycosyl hydrolase)
ProGP265 (Rv2799)
ProGP266 (LprA)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP270 (BlaC)
ProGP271 (FecB)
ProGP272 (LppL)
ProGP273 (LppX (Putative lipoprotein))
ProGP274 (LppZ (Putative lipoprotein))
ProGP275 (LpqB lipoprotein)
ProGP276 (LpqF lipoprotein)
ProGP277 (LpqI)
ProGP278 (LpqN)
ProGP279 (LpqT (putative lipoprotein))
ProGP28 (Flagellin A1)
ProGP280 (LpqW (lipoprotein))
ProGP281 (LprF)
ProGP282 (prG)
ProGP283 (OppA)
ProGP284 (PonA2)
ProGP285 (PpiB)
ProGP286 (PstS2)
ProGP287 (PstS3)
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP29 (Flagellin A2)
ProGP290 (Rv0907)
ProGP291 (Rv0988)
ProGP292 (Rv1084)
ProGP293 (Rv2813)
ProGP294 (Secreted protease)
ProGP295 (Thioredoxin)
ProGP296 (FlaA (Flagellin))
ProGP297 (FlaB (Flagellin))
ProGP298 (FliC (Flagellin subunit))
ProGP299 (CcoP)
ProGP3 (S-layer glycoprotein)
ProGP30 (Flagellin B1)
ProGP300 (CycB)
ProGP301 (S-layer Protein)
ProGP302 (AniA)
ProGP303 (DsbA)
ProGP304 (Gna1946)
ProGP305 (Laz)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP307 (PotF)
ProGP308 (Sco)
ProGP309 (PstS (40 kDa))
ProGP31 (Flagellin B2)
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP313 (Hypothetical protein)
ProGP314 (Putative exported protein)
ProGP315 (Putative outer membrane protein)
ProGP316 (Srr1)
ProGP317 (BF3567)
ProGP318 (BF3918)
ProGP319 (BF0935)
ProGP32 (Flagellin B3)
ProGP320 (LppC)
ProGP321 (OmpA)
ProGP322 (EtpA Adhesin)
ProGP323 (JlpA (42-45 kDa antigen))
ProGP324 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP326 (FliC (Flagellin))
ProGP327 (LccA, an Archaeal Laccase)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP329 (FTH_1830)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP330 (FTH_0159)
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP334 (FTH_0311)
ProGP335 (FTH_1167)
ProGP336 (FTH_1761)
ProGP337 (FTH_1721)
ProGP338 (FTH_1293)
ProGP339 (FTH_0069)
ProGP34 (S-layer glycoprotein)
ProGP340 (FTH_1071)
ProGP341 (FTH_0414)
ProGP342 (FTH_0357)
ProGP343 (PilA (FTH_0384))
ProGP344 (SlaA (S-layer protein))
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP346 (Chondroitinase ABC)
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP348 (TfsB (S-layer protein))
ProGP349 (TF1259)
ProGP35 (β-1,4-Endoglucanases)
ProGP350 (TF2339)
ProGP351 (BF0810)
ProGP352 (Putative cell division protein)
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP357 (Putative lipoprotein)
ProGP358 (Putative membrane protein)
ProGP359 (Putative membrane protein)
ProGP36 (S-layer glycoprotein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP362 (Putative sulfatase family protein)
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP364 (Putative integral membrane protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP367 (Putative uncharacterized protein)
ProGP368 (Colicin V production protein)
ProGP369 (Putative membrane protein)
ProGP37 (S-layer glycoprotein)
ProGP370 (Putative exporting protein)
ProGP371 (Putative secreted protease)
ProGP372 (Putative periplasmic protein)
ProGP373 (Putative periplasmic protein)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP377 (Putative periplasmic protein)
ProGP378 (Putative membrane protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP38 (VGP (74 kDa))
ProGP380 (Putative periplasmic protein)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP382 (Putative secreted transglycosylase)
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP389 (Putative integral membrane protein)
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP390 (Putative sulfatase protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP392 (Putative periplasmic protein)
ProGP393 (Putative integral membrane protein)
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP399 (TfsA (S-layer protein))
ProGP4 (F-pilin)
ProGP40 (Long-fibril protein (LFP))
ProGP400 (Sublancin)
ProGP401 (Plantaricin ASM1)
ProGP402 (Glycocin F)
ProGP403 (FlaA (Flagellin))
ProGP404 (FlaB (Flagellin))
ProGP405 (TF0091)
ProGP406 (TF1056)
ProGP407 (EhaJ (autotranporter))
ProGP408 (FliC (Flagellin))
ProGP409 (FliC (Flagellin))
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP410 (DsbA)
ProGP411 (FTL_1096)
ProGP412 (OmpA/MotB)
ProGP413 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP416 (Putative Uncharacterized Protein)
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP42 (Cellobiosidase)
ProGP420 (FlaA (Polar flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP422 (LafA (Lateral flagellin))
ProGP423 (AniA)
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP425 (ABC Transporter (TreS))
ProGP426 (Oligopeptide binding protein)
ProGP427 (Hypothetical protein)
ProGP428 (Protease)
ProGP429 (Maltose ABC transporter)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP430 (Serine protease)
ProGP431 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP433 (Hypothetical protein)
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP435 (FasC (fasciclin domain protein))
ProGP436 (Acm2)
ProGP437 (FliC (Type B Flagellin))
ProGP438 (DnaK)
ProGP439 (Lp_2260)
ProGP44 (S-layer glycoprotein)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP442 (PdhC)
ProGP443 (FtsY)
ProGP444 (Lp_ 2793)
ProGP445 (FtsK1)
ProGP446 (Lp_3421)
ProGP447 (FtsZ)
ProGP448 (MOMP)
ProGP449 (PsrP (Adhesin))
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP450 (AtaC)
ProGP451 (COK_1394)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP454 (Rv1887)
ProGP455 (35kDa protein)
ProGP456 (Rv3835)
ProGP457 (LppO (Putative lipoprotein))
ProGP458 (ThuA)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP463 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP466 (Putative protein)
ProGP467 (Alanine and proline-rich secreted protein)
ProGP468 (C-terminal protease)
ProGP469 (MdtA multidrug resistance protein)
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP470 (Putative uncharacterized protein)
ProGP471 (Putative uncharacterized protein)
ProGP472 (Putative signal peptide)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP475 (Putative uncharacterized protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP477 (Putative cell division related protein)
ProGP478 (Putative uncharacterized protein)
ProGP479 (Putative lipoprotein)
ProGP48 (S-layer glycoprotein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP481 (CpxP-like protein)
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprotein)
ProGP484 (Putative exported protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP486 (Putative membrane protein)
ProGP487 (OM lipoprotein carrier LolA)
ProGP488 (OmlA)
ProGP489 (Cell division protein)
ProGP49 (S-layer glycoprotein)
ProGP490 (OmpA family protein)
ProGP491 (Putative uncharacterized protein)
ProGP492 (Type IV Pilin)
ProGP493 (CN)
ProGP494 (FliC (Flagellin))
ProGP495 (EF-P)
ProGP496 (PliA)
ProGP497 (Putative secretion protein)
ProGP498 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP5 (Factor PG-1)
ProGP50 (Flagellin A)
ProGP500 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP502 (Uncharacterized protein)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP506 (MetQ)
ProGP507 (Sco)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP509 (Ccop)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP510 (Translation elongation factor P (EF-P))
ProGP511 (Translation elongation factor P (EF-P))
ProGP512 (Enterocin F4-9)
ProGP513 (Knh)
ProGP514 (EmaA)
ProGP515 (NirK)
ProGP516 (C5)
ProGP517 (CcoP)
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP52 (Hypothetical protein)
ProGP520 (Hag flagellin)
ProGP521 (EF-P)
ProGP522 (Putative membrane fusion protein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP528 (FtsN)
ProGP529 (AcrA)
ProGP53 (33 kDa minor core flagellin)
ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrolase)
ProGP531 (Probable transmembrane protein)
ProGP532 (Probable serine protease protein)
ProGP533 (Probable m20-related peptidase)
ProGP534 (PilN)
ProGP535 (Probable lipoprotein)
ProGP536 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP538 (Probable transmembrane protein)
ProGP539 (PilA)
ProGP54 (34 kDa major core flagellin)
ProGP540 (Probable peptidase transmembrane protein)
ProGP541 (FtsL)
ProGP542 (Translation elongation factor P (EF-P))
ProGP543 (Flagellin A1)
ProGP544 (Flagellin A2)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP548 (Pilin A4)
ProGP549 (Pilin A6)
ProGP55 (Cell surface protein/S-layer protein)
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP553 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP555 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP557 (Hypothetical protein)
ProGP558 (ABC transporter substrate binding protei
ProGP559 (Pullulanase)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP560 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP562 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP564 (Hypothetical protein)
ProGP565 (Peptide binding protein)
ProGP566 (Multidrug RND transporter)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP57 (38 kDa antigen)
ProGP570 (Peptide transporter)
ProGP571 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP573 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP575 (Hypothetical protein)
ProGP576 (Penicillin amidase)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP578 (Cytochrome c biogenesis protein)
ProGP579 (Hypothetical protein)
ProGP58 (Thermopsin)
ProGP580 (Histidine kinase)
ProGP581 (Cytochrome c assembly)
ProGP582 (Metallophosphoesterase)
ProGP583 (ATP synthase subunit A)
ProGP584 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP586 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP59 (β-1, 4-D-glucosidase (51 kDa))
ProGP590 (Hypothetical protein)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP592 (Peptidase)
ProGP593 (Hypothetical protein)
ProGP594 (ABC transporter substrate binding protei
ProGP595 (Glycosyl transferase)
ProGP596 (Nitrate reductase beta subunit)
ProGP597 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP599 (Hypothetical protein)
ProGP6 (Cellulase CA)
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP600 (Hypothetical protein)
ProGP601 (Transglutaminase)
ProGP602 (FAD-dependent oxidoreductase)
ProGP603 (ABC transporter substrate binding protein)
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein)
ProGP606 (ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP609 (Hypothetical protein)
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP613 (Nitrous oxidase accessory protein)
ProGP614 (Glutamate dehydrogenase)
ProGP615 (Hypothetical protein)
ProGP616 (NADH dehydrogenase subunit D)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP618 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP62 (18 kDa and 32 kDa lectin binding proteins)
ProGP620 (Hypothetical protein)
ProGP621 (Sugar binding protein)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP623 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP625 (Hypothetical protein)
ProGP626 (Serpin)
ProGP627 (Hypothetical protein)
ProGP628 (ABC transporter substrate binding protein)
ProGP629 (ATPase)
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP630 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP634 (Peptide ABC transporter permease)
ProGP635 (TRAP ABC transporter)
ProGP636 (NosD)
ProGP637 (Cytochrome c biogenesis protein)
ProGP638 (Excisionase)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP640 (Primosomal protein)
ProGP641 (Hypothetical protein)
ProGP642 (Cytochrome c assembly protein)
ProGP643 (Glycosyltransferase)
ProGP644 (Hypothetical protein)
ProGP645 (ABC transporter substrate binding protein)
ProGP646 (Glycosyltransferase)
ProGP647 (Hypothetical protein)
ProGP648 (Nitrate reductase)
ProGP649 (Transcriptional regulator)
ProGP65 (24 kDa flagellin)
ProGP650 (Hypothetical protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP656 (RNA methyltransferase)
ProGP657 (Transcriptional regulator)
ProGP658 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP66 (25 kDa flagellin)
ProGP660 (Hypothetical protein)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP662 (30S ribosomal protein S2)
ProGP663 (Protein disulfide isomerase like protein)
ProGP664 (V-type ATPase subunit D)
ProGP665 (ABC transporter)
ProGP666 (ABC transporter)
ProGP667 (V-type ATP synthase subunit E)
ProGP668 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP67 (35 kDa flagellin)
ProGP670 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP672 (Hypothetical protein)
ProGP673 (FHA domain containing protein)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP678 (Hypothetical protein)
ProGP679 (Nitrate reductase alpha subunit)
ProGP68 (S-layer glycoprotein)
ProGP680 (Peptidase S8)
ProGP681 (Formate dehydrogenase)
ProGP682 (Flagellin)
ProGP683 (Flagellin)
ProGP684 (S-layer glycoprotein (pNG5138))
ProGP685 (Msp1)
ProGP686 (Ta0280)
ProGP687 (Ta1063)
ProGP688 (Ta1052)
ProGP689 (Ta0171)
ProGP69 (S-layer glycoprotein)
ProGP690 (Ta0261)
ProGP691 (Kustd1514)
ProGP692 (SpaCBA)
ProGP693 (Serine rich-repeat SrpA)
ProGP694 (Serine rich-repeat SrpB)
ProGP695 (Serine rich-repeat SrpC)
ProGP696 (WpaA)
ProGP697 (Cnm)
ProGP698 (HgpA)
ProGP699 (Cellulose A)
ProGP7 (Cellulase CB)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP700 (SlpA protein)
ProGP701 (hypothetical protein)
ProGP702 (hypothetical protein)
ProGP703 (Bacillicin CER074)
ProGP704 (Bacillicin BAG2O)
ProGP705 (Geocillicin)
ProGP706 (Listeriocytocin)
ProGP707 (CleA)
ProGP708 (WTA-wall teichoic acid)
ProGP709 (PalA)
ProGP71 (S-layer glycoprotein)
ProGP710 (Hyp1)
ProGP711 (Hyp2)
ProGP712 (Asm1)
ProGP713 (SRRP100-23)
ProGP714 (SRRP53608)
ProGP715 (LpqH)
ProGP716 (AcpM)
ProGP717 (Uncharacterized protein)
ProGP718 (Uncharacterized protein)
ProGP719 (Uncharacterized protein)
ProGP72 (Alkaline Phosphatase D)
ProGP720 (Aminotransferase)
ProGP721 (Aconitate hydratase)
ProGP722 (Acyl carrier protein)
ProGP723 (Adenylate kinase)
ProGP724 (Alanine--tRNA ligase)
ProGP725 (Alkaline protease secretion ATP-binding protein AprD)
ProGP726 (Alkaline protease secretion protein)
ProGP727 (N-acetyl-gamma-glutamyl-phosphate reductase)
ProGP728 (Ornithine carbamoyltransferase)
ProGP729 (Argininosuccinate synthase)
ProGP73 (p115/ PAAP)
ProGP730 (Argininosuccinate lyase)
ProGP731 (Arginine biosynthesis bifunctional protein ArgJ)
ProGP732 (Aspartate-semialdehyde dehydrogenase)
ProGP733 (Aspartate--tRNA(Asp/Asn) ligase)
ProGP734 (Putative ATP synthase epsilon chain 2)
ProGP735 (ATP synthase gamma chain)
ProGP736 (ATP synthase subunit delta)
ProGP737 (ATP synthase B chain)
ProGP738 (Carbamoyl-phosphate synthase small chain)
ProGP739 (Carbamoyl-phosphate synthase large chain)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP740 (ATP-dependent Clp protease proteolytic subunit)
ProGP741 (Cytochrome c oxidase subunit 2)
ProGP742 (Cytochrome c oxidase subunit 1)
ProGP743 (Cytochrome c homolog)
ProGP744 (Cysteine--tRNA ligase)
ProGP745 (4-hydroxy-tetrahydrodipicolinate reductase)
ProGP746 (Peptide deformylase)
ProGP747 (DNA/pantothenate metabolism flavoprotein homolog)
ProGP748 (Chaperone protein DnaJ)
ProGP749 (DNA polymerase III subunit beta)
ProGP75 (S-layer glycoprotein)
ProGP750 (DNA polymerase III subunit gamma/tau)
ProGP751 (Deoxyuridine 5'-triphosphate nucleotidohydrolase)
ProGP752 ((Dimethylallyl)adenosine tRNA methylthiotransferase)
ProGP753 (GTPase Der)
ProGP754 (Enolase)
ProGP755 (Hemolysin cluster)
ProGP756 (VirB8 protein)
ProGP757 (Uncharacterized protein)
ProGP758 (Uncharacterized protein)
ProGP759 (Uncharacterized protein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP760 (Uncharacterized protein)
ProGP761 (Uncharacterized protein)
ProGP762 (Uncharacterized protein)
ProGP763 (Uncharacterized protein)
ProGP764 (Uncharacterized protein)
ProGP765 (Uncharacterized protein)
ProGP766 (Uncharacterized protein)
ProGP767 (Uncharacterized protein)
ProGP768 (ABC transporter substrate binding protein)
ProGP769 (Uncharacterized protein)
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP770 (Uncharacterized protein)
ProGP771 (Uncharacterized protein)
ProGP772 (Uncharacterized protein)
ProGP773 (uncha/CBS/transporter associated domain protein)
ProGP774 (Histidine kinase PleC)
ProGP775 (Uncharacterized protein)
ProGP776 (Uncharacterized protein)
ProGP777 (Uncharacterized protein)
ProGP778 (Uncharacterized protein)
ProGP779 (Putative regulatory component of sensory transduction system PleD)
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP780 (Uncharacterized protein)
ProGP781 (Uncharacterized protein)
ProGP782 (Uncharacterized protein)
ProGP783 (Deoxyguanosinetriphosphate triphosphohydrolase-like protein)
ProGP784 (Probable sigma(54) modulation protein)
ProGP785 (Uncharacterized protein)
ProGP786 (Uncharacterized protein)
ProGP787 (Uncharacterized protein)
ProGP788 (Uncharacterized protein)
ProGP789 (Uncharacterized protein)
ProGP79 (S-layer glycoprotein)
ProGP790 (Uncharacterized protein)
ProGP791 (Probable aminoglycoside efflux pump (Acriflavine resistance protein D))
ProGP792 (Similar to human and bovine Cytochrome c1)
ProGP793 (Uncharacterized protein)
ProGP794 (Uncharacterized protein)
ProGP795 (VirB6 protein)
ProGP796 (VirB6 protein)
ProGP797 (VirB6 protein)
ProGP798 (VirB6 protein)
ProGP799 (Uncharacterized protein)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP800 (Uncharacterized protein)
ProGP801 (Uncharacterized protein)
ProGP802 (Uncharacterized protein)
ProGP803 (Carboxypeptidase 1)
ProGP804 (Uncharacterized protein)
ProGP805 (Uncharacterized protein)
ProGP806 (Uncharacterized protein)
ProGP807 (Uncharacterized protein)
ProGP808 (Fructose-1,6-bisphosphatase)
ProGP809 (Uncharacterized protein)
ProGP81 (S-layer glycoprotein)
ProGP810 (Uncharacterized protein)
ProGP811 (Uncharacterized protein)
ProGP812 (Uncharacterized protein)
ProGP813 (Uncharacterized protein)
ProGP814 (Uncharacterized protein)
ProGP815 (Uncharacterized protein)
ProGP816 (Hypothetical zinc protease)
ProGP817 (Uncharacterized protein)
ProGP818 (Uncharacterized protein)
ProGP819 (50S ribosomal protein L31)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP820 (Uncharacterized protein)
ProGP821 (Uncharacterized protein)
ProGP822 (Uncharacterized protein)
ProGP823 (Hypothetical zinc protease)
ProGP824 (Hypothetical zinc protease)
ProGP825 (Putative transferase)
ProGP826 (Zinc metalloprotease)
ProGP827 (Uncharacterized protein)
ProGP828 (Uncharacterized protein)
ProGP829 (Map1-related protein)
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP830 (Map1-related protein)
ProGP831 (3-oxoacyl-[acyl-carrier-protein] synthase 2)
ProGP832 (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ)
ProGP833 (Probable 3-hydroxyacyl-CoA dehydrogenase)
ProGP834 (Probable fructose-bisphosphate aldolase class I)
ProGP835 (Signal recognition particle protein)
ProGP836 (Methionyl-tRNA formyltransferase)
ProGP837 (Folylpolyglutamate synthase)
ProGP838 (Bifunctional protein FolD)
ProGP839 (Ribosome-recycling factor)
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP840 (Cell division protein ftsA)
ProGP841 (ATP-dependent zinc metalloprotease FtsH)
ProGP842 (DNA translocase ftsK)
ProGP843 (Signal recognition particle receptor FtsY)
ProGP844 (Cell division protein FtsZ)
ProGP845 (Fumarate hydratase class II)
ProGP846 (Fragment of Glutamyl-tRNA(Gln) amidotransferase subunit A (Duplication))
ProGP847 (Aspartyl/glutamyl-tRNA amidotransferase subunit B)
ProGP848 (Proton/sodium-glutamate symport protein)
ProGP849 (Glutamate--tRNA ligase)
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP850 (Glutamate--tRNA ligase 1)
ProGP851 (Glycine--tRNA ligase alpha subunit)
ProGP852 (Glycine--tRNA ligase beta subunit)
ProGP853 (2,3-bisphosphoglycerate-independent phosphoglycerate mutase)
ProGP854 (Glycerol-3-phosphate dehydrogenase [NAD(P)+])
ProGP855 (Transcription elongation factor)
ProGP856 (Glutaredoxin)
ProGP857 (GMP synthase [glutamine-hydrolyzing])
ProGP858 (Inosine-5'-monophosphate dehydrogenase)
ProGP859 (DNA gyrase subunit A)
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP860 (5-aminolevulinate synthase)
ProGP861 (Delta-aminolevulinic acid dehydratase)
ProGP862 (Coproporphyrinogen oxidase)
ProGP863 (Protein HflC)
ProGP864 (Protease activity modulator hflk)
ProGP865 (Histidine--tRNA ligase)
ProGP866 (ATP-dependent protease ATPase subunit HslU)
ProGP867 (ATP-dependent protease subunit HslV)
ProGP868 (Chaperone protein HtpG)
ProGP869 (Isoleucine--tRNA ligase)
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP870 (Translation initiation factor IF-1)
ProGP871 (Translation initiation factor IF-2)
ProGP872 (Translation initiation factor IF-3)
ProGP873 (Cysteine desulfurase IscS)
ProGP874 (Octaprenyl-diphosphate synthase)
ProGP875 (4-diphosphocytidyl-2-C-methyl-D-erythritol kinase)
ProGP876 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin))
ProGP877 (Glutathione-regulated potassium-efflux system protein)
ProGP878 (Elongation factor 4)
ProGP879 (Signal peptidase I)
ProGP88 (S-layer glycoprotein)
ProGP880 (Leucine--tRNA ligase)
ProGP881 (Apolipoprotein N-acyltransferase)
ProGP882 (Lon protease)
ProGP883 (Dihydrolipoyl dehydrogenase)
ProGP884 (Diaminopimelate decarboxylase)
ProGP885 (Aspartokinase)
ProGP886 (Lysine--tRNA ligase)
ProGP887 (Methionine aminopeptidase)
ProGP888 (Major antigenic protein 1)
ProGP889 (Methionine--tRNA ligase)
ProGP89 (Surface layer glycoprotein)
ProGP890 (Putative ribonucleotide transport ATP-binding protein )
ProGP891 (Lipid A export ATP-binding protein)
ProGP892 (DNA mismatch repair protein)
ProGP893 (DNA mismatch repair protein MutS)
ProGP894 (Iron-sulfur cluster assembly scaffold protein IscU)
ProGP895 (Similar to lipoprotein nlpD)
ProGP896 (Ribonucleoside-diphosphate reductase)
ProGP897 (Ribonucleoside-diphosphate reductase subunit beta)
ProGP898 (NADH-quinone oxidoreductase subunit C)
ProGP899 (NADH-quinone oxidoreductase subunit D)
ProGP9 (8 kDa fimbrae)
ProGP90 (Antigens)
ProGP900 (NADH-quinone oxidoreductase subunit F)
ProGP901 (NADH-quinone oxidoreductase chain G)
ProGP902 (NADH-quinone oxidoreductase subunit H)
ProGP903 (Transcription termination/antitermination protein NusA)
ProGP904 (Probable chromosome partitioning protein parB)
ProGP905 (Propionyl-CoA carboxylase alpha chain)
ProGP906 (Propionyl-CoA carboxylase beta chain)
ProGP907 (Pyruvate dehydrogenase E1 component, beta subunit)
ProGP908 (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
ProGP909 (Ubiquinol-cytochrome c reductase iron-sulfur subunit)
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP910 (Cytochrome b)
ProGP911 (Phosphoglycerate kinase)
ProGP912 (Phenylalanine--tRNA ligase alpha subunit)
ProGP913 (Phenylalanine--tRNA ligase beta subunit)
ProGP914 (Phosphoribosyl 1,2-cyclic phosphate phosphodiesterase)
ProGP915 (Possible 1-acyl-sn-glycerol-3-phosphate acyltransferase)
ProGP916 (Phosphate acyltransferase)
ProGP917 (PmbA protein homolog)
ProGP918 (Pyruvate, phosphate dikinase)
ProGP919 (Peptide chain release factor 1)
ProGP92 (Anitigen (1000 kDa protein))
ProGP920 (Pyrroline-5-carboxylate reductase)
ProGP921 (Proline/betaine transporter)
ProGP922 (Proline--tRNA ligase)
ProGP923 (Ribose-phosphate pyrophosphokinase)
ProGP924 (Adenylosuccinate synthetase)
ProGP925 (Phosphoribosylformylglycinamidine synthase subunit PurL)
ProGP926 (Phosphoribosylformylglycinamidine cyclo-ligase)
ProGP927 (Phosphoribosylglycinamide formyltransferase)
ProGP928 (Orotidine 5'-phosphate decarboxylase)
ProGP929 (CTP synthase)
ProGP93 (Protein complex)
ProGP930 (Uridylate kinase)
ProGP931 (Quinone oxidoreductase)
ProGP932 (DNA replication and repair protein RecF)
ProGP933 (Transcription termination factor Rho)
ProGP934 (6,7-dimethyl-8-ribityllumazine synthase)
ProGP935 (Ribonuclease E)
ProGP936 (50S ribosomal protein L1)
ProGP937 (50S ribosomal protein L6)
ProGP938 (50S ribosomal protein L9)
ProGP939 (50S ribosomal protein L18)
ProGP94 (Surface layer glycoprotein)
ProGP940 (50S ribosomal protein L25)
ProGP941 (DNA-directed RNA polymerase subunit omega)
ProGP942 (30S ribosomal protein S1)
ProGP943 (30S ribosomal protein S4)
ProGP944 (30S ribosomal protein S7)
ProGP945 (30S ribosomal protein S8)
ProGP946 (30S ribosomal protein S10)
ProGP947 (30S ribosomal protein S16)
ProGP948 (30S ribosomal protein S20)
ProGP949 (30S ribosomal protein S21)
ProGP95 (S-layer glycoprotein)
ProGP950 (Succinate dehydrogenase flavoprotein subunit)
ProGP951 (Succinate dehydrogenase iron-sulfur subunit)
ProGP952 (Protein translocase subunit SecA)
ProGP953 (Protein translocase subunit SecD)
ProGP954 (Protein translocase subunit SecY)
ProGP955 (Serine--tRNA ligase)
ProGP956 (Uncharacterized protein)
ProGP957 (Single-stranded DNA-binding protein)
ProGP958 (Inositol-1-monophosphatase)
ProGP959 (Transaldolase)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP960 (Putative thiamine biosynthesis oxidoreductase thiO)
ProGP961 (Threonine--tRNA ligase)
ProGP962 (Flavin-dependent thymidylate synthase)
ProGP963 (Trigger factor)
ProGP964 (tRNA(Ile)-lysidine synthase)
ProGP965 (Transketolase)
ProGP966 (TldD protein homolog)
ProGP967 (NADP-dependent malic enzyme)
ProGP968 (Outer membrane protein tolC)
ProGP969 (DNA topoisomerase 1)
ProGP97 (27kDa flagellin)
ProGP970 (Triosephosphate isomerase)
ProGP971 (VIRB9 protein)
ProGP972 (Thioredoxin reductase)
ProGP973 (Elongation factor Ts)
ProGP974 (GTP-binding protein TypA/BipA homolog)
ProGP975 (Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE)
ProGP976 (UvrABC system protein A)
ProGP977 (Hypothetical valine-tRNA ligase)
ProGP978 (VirB10 protein)
ProGP979 (VirD4 protein)
ProGP98 (32kDa flagellin)
ProGP980 (Ribosome-binding ATPase YchF)
ProGP981 (Membrane protein insertase YidC)
ProGP982 (Uncharacterized protein)
ProGP983 (Uncharacterized protein)
ProGP984 (Outer membrane protein assembly factor BamD)
ProGP985 (ATP-dependent Clp protease ATP-binding subunit clpA)
ProGP986 (Dihydroorotate dehydrogenase (quinone))
ProGP987 (Chromosomal replication initiator protein DnaA)
ProGP988 (Uncharacterized protein)
ProGP989 (Uncharacterized protein)
ProGP99 (PilE (pilin))
ProGP990 (Uncharacterized protein)
ProGP991 (Uncharacterized protein)
ProGP992 (Uncharacterized protein)
ProGP993 (Uncharacterized protein)
ProGP994 (Uncharacterized protein)
ProGP995 (Uncharacterized protein)
ProGP996 (Uncharacterized protein)
ProGP997 (Uncharacterized protein)
ProGP998 (Uncharacterized protein)
ProGP999 (Uncharacterized protein)
Search Display Criteria
all
Organism
Gene Information
Genome Information
Protein Information
Protein Structure
Glycosylation Status
Glycan Information
Protein Glycosylation linked (PGL) gene(s)
Accessory PGL Gene(s)
Literature
ProGP ID
ProGP33 (Streptococcal acid glycoprotein SAGP)
Validation Status
Uncharacterized
Organism Information
Organism Name
Streptococcus pyogenes strain Su
Domain
Bacteria
Classification
Phylum :
Firmicutes
Class :
Bacilli
Orders :
Lactobacillales
Family :
Streptococcaceae
Genus :
Streptococcus
Species :
pyogenes
Strain :
Su
Taxonomic ID (NCBI)
1314
Genome Information
GenBank
X55659
EMBL
X55659
Gene Information
Gene Name
arcA or sagP
Protein Information
Protein Name
Streptococcal acid glycoprotein SAGP
UniProtKB/SwissProt ID
P0C0B3
EMBL-CDS
CAA39192.1
UniProtKB Sequence
>sp|P0C0B3|ARCA_STRPY Arginine deiminase OS=Streptococcus pyogenes GN=arcA PE=1 SV=2 MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHDAFAQA LRDEGIEVLYLETLAAESLVTPEIREAFIDEYLSEANIRGRATKKAIRELLMAIEDNQEL IEKTMAGVQKSELPEIPASEKGLTDLVESNYPFAIDPMPNLYFTRDPFATIGTGVSLNHM FSETRNRETLYGKYIFTHHPIYGGGKVPMVYDRNETTRIEGGDELVLSKDVLAVGISQRT DAASIEKLLVNIFKQNLGFKKVLAFEFANNRKFMHLDTVFTMVDYDKFTIHPEIEGDLRV YSVTYDNEELHIVEEKGDLAELLAANLGVEKVDLIRCGGDNLVAAGREQWNDGSNTLTIA PGVVVVYNRNTITNAILESKGLKLIKIHGSELVRGRGGPRCMSMPFEREDI
Sequence length
411 AA
Subcellular Location
Intracellular
Function
Antitumour protein.
Literature
Year of Identification
1985
Year of Identification Month Wise
1985.1
Reference
Degnan, B.A., Fontaine, M.C., Doebereiner, A.H., Lee, J.J., Mastroeni, P., Dougan, G., Goodacre, J.A. and Kehoe, M.A., 2000. Characterization of an isogenic mutant of Streptococcus pyogenes Manfredo lacking the ability to make streptococcal acid glycoprotein. Infection and Immunity, 68(5), pp.2441-2448.
Corresponding Author
Degnan BA
Contact
School of Clinical Medical Sciences (Rheumatology), Medical School, University of Newcastle, Newcastle upon Tyne NE2 4HH, United Kingdom.
Reference
Degnan, B.A., Palmer, J.M., Robson, T., Jones, C.E.D., Fischer, M., Glanville, M., Mellor, G.D., Diamond, A.G., Kehoe, M.A. and Goodacre, J.A., 1998. Inhibition of human peripheral blood mononuclear cell proliferation by Streptococcus pyogenes cell extract is associated with arginine deiminase activity. Infection and Immunity, 66(7), pp.3050-3058.
Corresponding Author
J.A .Goodacre
Contact
School of Clinical Medical Sciences (Rheumatology), Immunological and Virological Sciences, The Medical School, University of Newcastle upon Tyne, Newcastle upon Tyne, NE2 4HH, United Kingdom
Reference
Kanaoka, M., Negoro, T., Kawanaka, C., Agui, H. and Nabeshima, S., 1991. Streptococcal antitumor protein: expression in Escherichia coli cells and properties of the recombinant protein. Agricultural and biological chemistry, 55(3), pp.743-750.
Corresponding Author
M Kanaoka
Contact
Takarazuka Research Center, Sumitomo Chemical Co., Ltd., Hyogo, Japan.
Reference
KANAOKA, M., FUKITA, Y., TAYA, K., KAWANAKA, C., NEGORO, T. and AGUI, H., 1987. Antitumor activity of streptococcal acid glycoprotein produced by Streptococcus pyogenes Su. Japanese Journal of Cancer Research GANN, 78(12), pp.1409-1414.
Corresponding Author
Hideo Agui
Contact
Biotechnology Laboratory, Takarazuka Research Center, Sumitomo Chemical Co. Ltd., Hyogo.
ProCGP (Characterized Glycoproteins)
is a compilation of bacterial and archaeal glycoproteins for which at least one site of glycosylation is validated experimentally using one or multiple methods like, site directed mutagenesis, Edman degradation, mass spectroscopy etc. Each entry in ProCGP has a unique identifier ProGP ID. ProCGP search allows user to seek experimentally verified information about an entry selected by using four different search criteria.
ProUGP (Uncharacterized Glycoproteins)
is a compilation of bacterial and archaeal glycoproteins that are known to be glycosylated from experiments like PAS staining, abberant migration on SDS-PAGE, lectin binding etc. but yet not mapped for the precise position of glycosylated residue (s) in a protein sequence. Each entry in ProUGP has a unique identifier ProGP ID. ProUGP search provides manually curated, published information about selected entry in ProUGP.
Choose Search Criteria
Choose
ProGP ID
Organism
Protein Name
UniProtKB/SwissProt ID
Glyco-group
Select Value
Select Value
Choose Display Criteria
All
Organism
Gene Information
Genome Information
Protein Information
Glycosylation Status
Glycan Information
Protein Glycosylation linked (PGL) gene(s)
Accessory PGL Gene(s)
Literature
ProGT_Main (Prokaryotic Protein Glycosyl Transferases):
is a compilation of bacterial and archaeal protein glycosyltransferases for which at least one genetic or biochemical evidence of glycosyltransferase activity is validated in the published literature. Each entry in ProGT_Main has a unique identifier ProGT ID. ProGT_Main search allows user to seek experimentally verified information about an entry selected by using four different search criteria
ProGT_Accessory (Accessory Protein or enzyme to Prokaryotic Protein Glycosyl Transferases):
is a compilation of such bacterial and archaeal proteins/enzyme that have miscellaneous accessory roles in a given protein glycosylation pathway of a characterized protein glycosyltransferases compiled in ProGT_Main. The qualifying criteria is at least one known genetic or biochemical evidence of accessory function, in literature. Each entry in ProGT_Accessory has a unique identifier ProGT ID. ProGT_Accessory search provides manually curated, published information about selected entry.
Choose Search Criteria
Choose
ProGT ID
Organism
Protein Name
UniProtKB/SwissProt ID
Glyco-group
Select Value
Search Display Criteria
All
Organism
Gene Information
Genome Information
Protein Name
Glycan Information
Acceptor Subtrate Information
Literature
Search Location
choose Database
Choose
Main
Accessory
ProCGP
ProUGP
Enter ID.
#ex1