ProGP338 (FTH_1293)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP338 (FTH_1293) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Francisella tularensis ssp. holarctica strain FSC200 |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Gammaproteobacteria Orders : Thiotrichales Family : Francisellaceae Genus : Francisella Species : tularensis Subspecies : holarctica Strain : FSC 200 |
| Taxonomic ID (NCBI) | 351581 |
| Genome Information | |
| GenBank | CP003862.1 |
| EMBL | CP003862.1 |
| Gene Information | |
| Gene Name | FTH_1293 |
| GenBank Gene Sequence | NC_008369.1 |
| Protein Information | |
| Protein Name | FTH_1293 |
| NCBI RefSeq | WP_043023490.1 |
| EMBL-CDS | ABI83137.1 |
| UniProtKB Sequence | >WP_043023490.1 OmpA family protein [Francisella tularensis] MRLKSIVIATTVLLGSATASIAAGSDNIDTSANSNSATTQSSGFAANNFIAPFANTYSALTNKDNTWGPQ DRTGQWYLGVDANGLAGTPNSPSGAGANFTIGYNINKYFAVQYNQLVGRVFAGLGEGVVNFSNNTMFTPY AAGGAGWANLAGQATGAWDVGGGLKFELSRNVQASVDYRYIQTMAPSNISGANGRAGTNMIGAGLTWFFG GKDTTNNDTGNIQDNGATTAAQTVAMPTIDESKYVLPAGIKQCEGNFNLTEDGVACYTVNGDDVTVYLDT KFAYDKATLNAKGKKAIASFVNFIKDSNISSVTVKGYASQGQTGSEFDIYNQKLSEKRAQAVADYMKQLG LDSEKIITKGFGYNDTLGGIHKSDPRNQRVEASVSAPLKEAN |
| Sequence length | 392 AA |
| Subcellular Location | Outer Membrane |
| Function | Outer membrane protein FopA |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | Hydrazide labeling, lectin blotting and lectin affinity chromatography |
| Literature | |
| Year of Identification | 2010 |
| Year of Identification Month Wise | 2010.4.5 |
| Reference | Balonova, L., Hernychova, L., Mann, B.F., Link, M., Bilkova, Z., Novotny, M.V. and Stulik, J., 2010. Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. Journal of proteome research, 9(4), pp.1995-2005. |
| Corresponding Author | Lenka Hernychova |
| Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
| Reference | Balonova, L., Mann, B.F., Cerveny, L., Alley, W.R., Chovancova, E., Forslund, A.L., Salomonsson, E.N., Forsberg, Å., Damborsky, J., Novotny, M.V. and Hernychova, L., 2012. Characterization of protein glycosylation in Francisella tularensis subsp. holarctica: identification of a novel glycosylated lipoprotein required for virulence. Molecular & Cellular Proteomics, 11(7), pp.M111-015016. |
| Corresponding Author | Lenka Hernychova |
| Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |