ProGP4 (F-pilin)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP4 (F-pilin) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Escherichia coli K12 |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Gammaproteobacteria Orders : Enterobacteriales Family : Enterobacteriaceae Genus : Esherichia Species : coli Strain : K12 |
| Taxonomic ID (NCBI) | 83333 |
| Genome Information | |
| GenBank | AP001918.1 |
| EMBL | AP001918.1 |
| Organism Additional Information | Escherichia coli (Gram-negative) is the predominant facultative organism in the human intestine. It is responsible for a number of diseases like urinary tract infections, gastroenteritis (diarrhoea), meningitis, traveler's diarrhea and hemorrhagic colitis. There are a myriad of serotypes of pathogenic E. coli. Adhesion to the host cells is an important step in its pathogenesis. However, most strains are harmless and normal flora residing in the gut. |
| Gene Information | |
| Gene Name | traA (ECOK12F074) |
| NCBI Gene ID | 1263548 |
| GenBank Gene Sequence | M11322 |
| Protein Information | |
| Protein Name | F-pilin |
| UniProtKB/SwissProt ID | P04737 |
| NCBI RefSeq | WP_000994779.1 |
| EMBL-CDS | AAC44177.1 |
| UniProtKB Sequence | >sp|P04737|PIL1_ECOLI Pilin OS=Escherichia coli (strain K12) OX=83333 GN=traA PE=1 SV=1 MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAGSSGQDLM ASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVG L |
| Sequence length | 121 AA |
| Subcellular Location | Surface |
| Function | Major protein of F pilus (sex pili). |
| Protein Structure | |
| PDB ID | 5LER, 5LFB |
| Glycan Information | |
| Glycan Annotation | One covalently bound glucose molecule per pilin subunit. |
| Literature | |
| Year of Identification | 1975 |
| Year of Identification Month Wise | 1975.1 |
| Reference | Tomoeda, M., Inuzuka, M. and Date, T., 1976. Bacterial sex pili. Progress in biophysics and molecular biology, 30, pp.23-56. |
| Reference | Brinton, C.C. and Baron, L., 1971. The properties of sex pili, the viral nature of “conjugal” genetic transfer systems, and some possible approaches to the control of bacterial drug resistance. CRC critical reviews in microbiology, 1(1), pp.105-160. |
| Corresponding Author | Charles C. Brinton |
| Contact | Department of Biological Sciences, University of Pittsburgh, PA 15260. |
