ProGP402 (Glycocin F)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP402 (Glycocin F) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Lactobacillus plantarum KW30 |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Lactobacillales Family : Lactobacillaceae Genus : Lactobacillus Species : plantarum Strain : A-1 |
| Taxonomic ID (NCBI) | 1590 |
| Genome Information | |
| GenBank | GU552553 |
| EMBL | GU552553 |
| Gene Information | |
| Gene Name | gccF |
| Protein Information | |
| Protein Name | Glycocin F |
| UniProtKB/SwissProt ID | E9K9Z1 |
| EMBL-CDS | ADV57366.1 |
| UniProtKB Sequence | >tr|E9K9Z1|E9K9Z1_LACPL Prebacteriocin glycocin F OS=Lactobacillus plantarum GN=gccF PE=4 SV=1 MSKLVKTLTISEISKAQNNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSS SYHC |
| Sequence length | 64 AA |
| Subcellular Location | Secreted |
| Function | Glycocin F is a bacteriocin that possesses bacteriostatic activity. This activity is reversed by free N-acetylglucosamine. |
| Protein Structure | |
| PDB ID | 2KUY |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser) and S- (Cys) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | (Signal peptide: 1-21) S39, C64 |
| Experimentally Validated Glycosite(s ) in Mature Protein | S18, C43, S43, C18 |
| Glycosite(s) Annotated Protein Sequence | >tr|E9K9Z1|E9K9Z1_LACPL Prebacteriocin glycocin F OS=Lactobacillus plantarum GN=gccF PE=4 SV=1 MSKLVKTLTISEISKAQNNGGKPAWCWYTLAMCGAGYDS*(39)GTCDYMYSHCFGIKHHSSGSS SYHC*(64) |
| Sequence Around Glycosites (21 AA) | TLAMCGAGYDSGTCDYMYSHC
HHSSGSSSYHC |
| Technique(s) used for Glycosylation Detection | Mass difference measured and accounted for by Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR-MS) with electron capture dissociation (ECD) |
| Technique(s) used for Glycosylated Residue(s) Detection | Edman sequencing and Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR-MS) |
| Protein Glycosylation- Implication | O-linked N-acetylglucosamine is required for bacteriostatic activity. |
| Glycan Information | |
| Glycan Annotation | Linkages:β-GlcNAc-Ser, HexNAc-Cys. N-Acetylglucosamine isβ-O-linked to Ser18 and N-acetylhexosamine is S-linked to C-terminal Cys43. |
| Technique(s) used for Glycan Identification | N-acetyl-β-D-glucosaminidase GcnA treatment. |
| Protein Glycosylation linked (PGL) gene(s) | |
| Predicted Accessory Gene(s) | Glycosyltransferase GccA (encoded in the gcc gene cluster) glycosylates Ser18 and/or Cys43 of preglycocin F. |
| Literature | |
| Year of Identification | 2011 |
| Year of Identification Month Wise | 2011.5.20 |
| Year of Validation | 2011 |
| Reference | Stepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlíček, V., Patchett, M.L. and Norris, G.E., 2011. Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins. FEBS letters, 585(4), pp.645-650. |
| Corresponding Author | Gillian E. Norris |
| Contact | Institute of Molecular Biosciences, Massey University, Palmerston North, New Zealand. |
| Reference | Venugopal, H., Edwards, P.J., Schwalbe, M., Claridge, J.K., Libich, D.S., Stepper, J., Loo, T., Patchett, M.L., Norris, G.E. and Pascal, S.M., 2011. Structural, dynamic, and chemical characterization of a novel S-glycosylated bacteriocin. Biochemistry, 50(14), pp.2748-2755. |
| Corresponding Author | Hariprasad Venugopal Steven M Pascal |
| Contact | Institute of Fundamental Sciences, Massey University, Palmerston North, New Zealand. |
| Reference | Amso, Z., Bisset, S.W., Yang, S.H., Harris, P.W., Wright, T.H., Navo, C.D., Patchett, M.L., Norris, G.E. and Brimble, M.A., 2018. Total chemical synthesis of glycocin F and analogues: S-glycosylation confers improved antimicrobial activity. Chemical science, 9(6), pp.1686-1691. |
| Corresponding Author | Gillian E. Norris and Margaret A. Brimble |
| Contact | Institute of Fundamental Sciences, Massey University, Colombo Rd, Palmerston North 4442, New Zealand Maurice Wilkins Centre for Molecular Biodiscovery, The University of Auckland, Private Bag 92019, Auckland 1142, New Zealand School of Chemical Sciences, The University of Auckland, 23 Symonds St, Auckland 1142, New Zealand. School of Biological Sciences, The University of Auckland, 3 Symonds St, Auckland 1142, New Zealand |
| Reference | Drummond, B.J., Loo, T.S., Patchett, M.L. and Norris, G.E., 2021. Optimized Genetic Tools Allow the Biosynthesis of Glycocin F and Analogues Designed To Test the Roles of gcc Cluster Genes in Bacteriocin Production. Journal of bacteriology, 203(7), pp.e00529-20. |
| Corresponding Author | Gillian E. Norris |
| Contact | aSchool of Fundamental Sciences, Massey University, Palmerston North, New Zealand Maurice Wilkins Centre for Molecular Biodiscovery, The University of Auckland, Auckland, New Zealand |
| Reference | Brimble, M.A., Edwards, P.J., Harris, P.W., Norris, G.E., Patchett, M.L., Wright, T.H., Yang, S.H. and Carley, S.E., 2015. Synthesis of the antimicrobial S‐linked glycopeptide, Glycocin F. Chemistry–A European Journal, 21(9), pp.3556-3561. |
| Corresponding Author | Margaret A. Brimble |
| Contact | School of Chemical Sciences, The University of Auckland23 Symonds St., Auckland 1142 (New Zealand) |
