ProGP413 (Putative Uncharacterized Protein)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP413 (Putative Uncharacterized Protein) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Acinetobacter baumannii ATCC 17978 |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : gammaproteobacteria Orders : Pseudomonadales Family : Moraxellaceae Genus : Acinetobacter Species : baumannii Strain : ATCC 17978 |
| Taxonomic ID (NCBI) | 400667 |
| Genome Information | |
| GenBank | CP000521.1 |
| EMBL | CP018664.1 |
| Organism Additional Information | Acinetobacter baumannii is an opportunistic nosocomial pathogen infecting immunocompromised patients. It causes pneumonia, septicaemia, urinary tract infections and meningitis. There has been a rise in the multidrug-resistant as well as pandrug-resistant strains of the superbug. |
| Gene Information | |
| Gene Name | A1S_0556 |
| GenBank Gene Sequence | CP000521.1 |
| Protein Information | |
| Protein Name | Putative Uncharacterized Protein |
| NCBI RefSeq | ABO11009 |
| EMBL-CDS | ABO11009.1 |
| UniProtKB Sequence | >ABO11009.2 hypothetical protein A1S_0556 [Acinetobacter baumannii ATCC 17978] MLTSKASLHLTLLASAIFLVACQPKSDPKESEDQQKPAVVEQKPVELTLKGETVPSKVTLPDCDGKTCPE FTVERLQSNFPFIDKIIDQQVLKALGQILEIAEPDAKAAQADKKTEASAAATTEQQDSFDAQVQRYANSF IDLDNELKALSSNHQINLLVKPKIIQSQGKVVTVVVNSSSYLGGAHGSAAQQYYNFDLKKEKQVKLEDLL RPEKKAALEKLAHEAFKAWVTDSKLANSVSEYEQAWPFKLTENFLLGDQGLILQYGEYEIGPYVVGLPRL VIPYDQLQEVLKEEYLPQPKAKPASTPAVKSAS |
| Sequence length | 313 AA |
| Subcellular Location | Membrane |
| Function | Unknown |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | ZIC HILIC and Mass spectrometry (LTQ-Orbitrap Velos) |
| Glycan Information | |
| Glycan Annotation | Pentasaccharideβ-GlcNAc3NAcA4OAc-4-(β-GlcNAc-6-)-α-Gal-6-β-Glc-3-β-GalNAc-S/T.β-GlcNAc3NAcA4OAcA is an O-acetylated derivative of glucuronic acid. |
| GlyTouCan | G09064NU |
| Technique(s) used for Glycan Identification | 1H:13C HSQC 2D NMR and mass spectrometry |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PglLAb |
| OST ProGT ID | ProGT55 |
| Accessory Gene(s)Progt ID | ProGT55.1 |
| Literature | |
| Year of Identification | 2012 |
| Year of Identification Month Wise | 2012.06.07 |
| Reference | Iwashkiw, J.A., Seper, A., Weber, B.S., Scott, N.E., Vinogradov, E., Stratilo, C., Reiz, B., Cordwell, S.J., Whittal, R., Schild, S. and Feldman, M.F., 2012. Identification of a general O-linked protein glycosylation system in Acinetobacter baumannii and its role in virulence and biofilm formation. PLoS pathogens, 8(6), p.e1002758. |
| Corresponding Author | Mario F Feldman |
| Contact | Alberta Glycomics Centre, Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada |
