ProGP517 (CcoP)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP517 (CcoP) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Neisseria elongata subsp. glycolytica |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Betaproteobacteria Orders : Neisseriales Family : Neisseriaceae Genus : Neisseria Species : elongata Subspecies : glycolytica Strain : ATCC 29315 |
| Taxonomic ID (NCBI) | 546263 |
| Genome Information | |
| GenBank | ADBF01000023 |
| EMBL | ADBF01000023 |
| Gene Information | |
| Gene Name | ccoP (NEIELOOT_01860) |
| Protein Information | |
| Protein Name | CcoP |
| UniProtKB/SwissProt ID | D4DS17 |
| EMBL-CDS | EFE49362.1 |
| UniProtKB Sequence | >tr|D4DS17|D4DS17_NEIEG Cytochrome C oxidase, Cbb3-type, subunit III OS=Neisseria elongata subsp. glycolytica ATCC 29315 GN=ccoP PE=4 SV=1 MNTTSHFTSDFWNYYIIGIVVLSFIGLIWLLLSQNKVKPLKKGKMSIPQGITGMVLKNTT IPCRAGGSSCTSGLGCSVSAIW |
| Sequence length | 82 AA |
| Subcellular Location | Membrane |
| Function | A c-type triheme cytochrome |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | Difference in mobility on immunoblots |
| Glycan Information | |
| Glycan Annotation | A Tetrasaccharide glycoform consisting of di-N-acetylbacillosamine-glucose-di-N-acetyl hexuronic acid-N-acetylhexosamine (diNAcBac-Glc-diNAcHexA-HexNAc). |
| Technique(s) used for Glycan Identification | Mass spectrometry |
| Literature | |
| Year of Identification | 2015 |
| Year of Identification Month Wise | 2015.10.19 |
| Reference | Anonsen, J.H., Vik, Å., Børud, B., Viburiene, R., Aas, F.E., Kidd, S.W., Aspholm, M. and Koomey, M., 2016. Characterization of a unique tetrasaccharide and distinct glycoproteome in the O-linked protein glycosylation system of Neisseria elongata subsp. glycolytica. Journal of bacteriology, 198(2), pp.256-267. |
| Corresponding Author | Michael Koomey |
| Contact | Department of Biosciences, University of Oslo, Oslo, Norway |
