ProGP705 (Geocillicin)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP705 (Geocillicin) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Geobacillus sp. 8 |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Bacillales Family : Bacillaceae Genus : Geobacillus |
| Taxonomic ID (NCBI) | 33936 |
| Gene Information | |
| Gene Name | geocillicin |
| Protein Information | |
| Protein Name | Geocillicin |
| NCBI RefSeq | WP_066251537.1 |
| UniProtKB Sequence | >WP_066251537.1 pallidocin [Aeribacillus pallidus] GYSAAQCAWMALSCVNYIPGVGFGCGGYSACELYKRYC |
| Subcellular Location | Secreted |
| Function | Show antimicrobial activity against Bacillus cereus ATCC 14581 |
| Glycosylation Status | |
| Glycosylation Type | S-(Cys) linked |
| Experimentally Predicted Glycosites | C25 |
| Experimentally Validated Glycosite(s) in Full Length Protein | C25 |
| Experimentally Validated Glycosite(s ) in Mature Protein | >WP_066251537.1 pallidocin [Aeribacillus pallidus] GYSAAQCAWMALSCVNYIPGVGFGC*(25)GGYSACELYKRYC |
| Glycosite(s) Annotated Protein Sequence | NYIPGVGFGCGGYSACELYK |
| Technique(s) used for Glycosylation Detection | MS/MS analysis |
| Glycan Information | |
| Glycan Annotation | glucose |
| Technique(s) used for Glycan Identification | MS/MS analysis |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | GT |
| OST ProGT ID | ProGT129 (GT) |
| Literature | |
| Year of Identification | 2018 |
| Reference | Ren, H., Biswas, S., Ho, S., Van Der Donk, W.A. and Zhao, H., 2018. Rapid discovery of glycocins through pathway refactoring in Escherichia coli. ACS chemical biology, 13(10), pp.2966-2972. |
| Corresponding Author | Wilfred A. van der Donk Huimin Zhao |
| Contact | Department of Chemistry, Howard Hughes Medical Institute, Carl R. Woese Institute for Genomic Biology, University of Illinois at Urbana?Champaign, Urbana, Illinois 61801, United States |