ProGP709 (PalA)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP709 (PalA) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Aeribacillus pallidus 8 |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Bacillales Family : Bacillaceae Genus : Aeribacillus Species : pallidus Strain : 8 |
| Taxonomic ID (NCBI) | 33936 |
| Genome Information | |
| GenBank | LVHY01000134.1 |
| Gene Information | |
| Gene Name | pal |
| Protein Information | |
| Protein Name | PalA |
| NCBI RefSeq | WP_066251537.1 |
| UniProtKB Sequence | >WP_066251537.1 pallidocin [Aeribacillus pallidus] GYSAAQCAWMALSCVNYIPGVGFGCGGYSACELYKRYC |
| Subcellular Location | Secreted |
| Function | Show antimicrobial activity against Bacillus cereus ATCC 14579 |
| Glycosylation Status | |
| Glycosylation Type | S-(Cys) linked |
| Experimentally Predicted Glycosites | C25 |
| Experimentally Validated Glycosite(s) in Full Length Protein | C25 |
| Experimentally Validated Glycosite(s ) in Mature Protein | >WP_066251537.1 pallidocin [Aeribacillus pallidus] GYSAAQCAWMALSCVNYIPGVGFGC*(25)GGYSACELYKRYC |
| Glycosite(s) Annotated Protein Sequence | NYIPGVGFGCGGYSACELYK |
| Technique(s) used for Glycosylation Detection | LC-ESI-QMS/MS mass spectrometery |
| Technique(s) used for Glycosylated Residue(s) Detection | LC-ESI-QMS/MS mass spectrometery |
| Glycan Information | |
| Glycan Annotation | Hexose (glucose) |
| Technique(s) used for Glycan Identification | GC-MS |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PalS |
| OST ProGT ID | ProGT131 (PalS) |
| Literature | |
| Year of Identification | 2019 |
| Reference | Kaunietis, A., Buivydas, A., Čitavičius, D.J. and Kuipers, O.P., 2019. Heterologous biosynthesis and characterization of a glycocin from a thermophilic bacterium. Nature communications, 10(1), pp.1-12. |
| Corresponding Author | Oscar P Kuipers |
| Contact | Molecular Genetics Dept., Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, Nijenborgh 7, 9747 AG, Groningen, Netherlands. |