ProGP819 (50S ribosomal protein L31)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP819 (50S ribosomal protein L31) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Ehrlichia ruminantium |
Domain | Bacteria |
Classification | Phylum : Proteobacteria Class : Alphaproteobacteria Orders : Rickettsiales Family : Anaplasmataceae Genus : Ehrlichia Species : ruminantium Strain : Gardel |
Taxonomic ID (NCBI) | 302409 |
Genome Information | |
Organism Additional Information | Ehrlichia ruminantium is an obligate intracellular bacterium that causes heartwater, a fatal tick-borne disease of livestock |
Gene Information | |
Gene Name | ERGA_CDS_07790 |
NCBI Gene ID | NC_006831.1 |
Protein Information | |
Protein Name | 50S ribosomal protein L31 |
UniProtKB/SwissProt ID | Q5FG89 |
UniProtKB Sequence | >tr|Q5FG89|Q5FG89_EHRRG Uncharacterized protein OS=Ehrlichia ruminantium (strain Gardel) OX=302409 GN=ERGA_CDS_07790 MRKGIHPETYDILTVFTNGEERVMKSTLGKKDEMIRIHLESDCFNHPAWNPSLRATSKKNSKAAKFLSKFGDLDL |
Subcellular Location | Ribosome |
Function | Translation |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | nLC–MS/MS Analysis |
Literature | |
Year of Identification | 2019 |
Reference | Marcelino, I., Colomé-Calls, N., Holzmuller, P., Lisacek, F., Reynaud, Y., Canals, F. and Vachiéry, N., 2019. Sweet and sour ehrlichia: Glycoproteomics and phosphoproteomics reveal new players in Ehrlichia ruminantium physiology and pathogenesis. Frontiers in microbiology, 10, p.450. |
Corresponding Author | Isabel Marcelino |
Contact | 1. CIRAD, UMR ASTRE, Petit-Bourg, France. 2. ASTRE, CIRAD, INRA, Université de Montpellier, Montpellier, France. 3. Unitè TReD-Path (Transmission Rèservoirs et Diversitè des Pathogènes), Institut Pasteur de Guadeloupe, Les Abymes, France. |