ProGT10.8 (PglD) Home -> ProGTdb -> Search ProGT_Accessory -> Display data Selected ID ProGT10.8 (PglD) ProGT1.1 (WbpM) ProGT1.2 (WbpL) ProGT9.1 (PglE) ProGT10.1 (PglH) ProGT10.2 (PglA) ProGT10.3 (PglJ) ProGT10.4 (PglI) ProGT10.5 (PglE) ProGT10.6 (PglF) ProGT10.7 (PglC) ProGT10.8 (PglD) ProGT10.9 (PglK) ProGT10.10 (PseB) ProGT10.11 (PseG) ProGT12.1 (Ppm1) ProGT13.1 (GlmS) ProGT13.2 (GlmM) ProGT13.3 (WecB) ProGT13.4 (WecC) ProGT13.5 (AglO) ProGT13.6 (AglA) ProGT13.7 (AglL) ProGT13.8 (AglH) ProGT13.9 (Agl17) ProGT13.10 (AglX) ProGT13.11 (AglY) ProGT13.12 (AglZ) ProGT13.13 (AglU) ProGT13.14 (AglV) ProGT13.15 (Agl18) ProGT13.16 (Agl19) ProGT13.17 (Agl20) ProGT13.18 (Agl21) ProGT13.19 (AglW) ProGT14.1 (Ppm1) ProGT15.1 (AglD) ProGT15.2 (AglE) ProGT15.3 (AglF) ProGT15.4 (AglG) ProGT15.5 (AglI) ProGT15.6 (AglJ) ProGT15.7 (AglM) ProGT15.8 (AglP) ProGT15.9 (AglS) ProGT15.10 (AglR) ProGT15.11 (Agl5) ProGT15.12 (Agl6) ProGT15.13 (Agl7) ProGT15.14 (Agl8) ProGT15.15 (Agl9) ProGT15.16 (Agl10) ProGT15.17 (Agl11) ProGT15.18 (Agl12) ProGT15.19 (Agl13) ProGT15.20 (Agl14) ProGT15.21 (Agl15) ProGT15.22 (AglQ) ProGT16.1 (AglA) ProGT16.2 (AglH) ProGT16.3 (AglC) ProGT16.4 (AglK) ProGT17.1 (PglB) ProGT17.2 (PglC) ProGT17.3 (PglD) ProGT17.4 (PglE) ProGT17.5 (PglF) ProGT17.6 (PglI) ProGT18.1 (PseC) ProGT18.2 (PseF) ProGT18.3 (PseI) ProGT18.4 (PseA) ProGT18.5 (PseG) ProGT18.6 (PseH) ProGT18.7 (PseB) ProGT18.8 (PseH) ProGT21.1 (PglA) ProGT21.2 (PglD) ProGT21.3 (PglF) ProGT21.4 (PgIC) ProGT21.5 (PglE) ProGT21.6 (PglI) ProGT24.1 (PglB2) ProGT24.2 (PglC) ProGT24.3 (PglD) ProGT24.4 (PglH) ProGT25.1 (PglA) ProGT25.2 (PglB2) ProGT25.3 (PglC) ProGT25.4 (PglD) ProGT25.5 (PglF) ProGT29.1 (GalT2) ProGT29.2 (Gly) ProGT33.1 (GtfC) ProGT33.2 (GtfD) ProGT33.3 (GtfE) ProGT33.4 (GtfF) ProGT33.5 (GtfG) ProGT33.6 (GtfH) ProGT35.1 (Ppm1) ProGT37.1 (Gtf3) ProGT37.2 (dGT1) ProGT42.1 (Alpha-1,6-glucosyltransferase) ProGT51.1 (Agl3) ProGT51.2 (Agl16) ProGT51.3 (AglH) ProGT54.1 (FlmA) ProGT54.2 (FlmB) ProGT54.3 (NeuA) ProGT54.4 (FlmD) ProGT54.5 (NeuB) ProGT55.1 (PglC) ProGT56.1 (PglH) ProGT56.2 (PglI) ProGT56.3 (PglJ) ProGT56.4 (PglA) ProGT56.5 (PglC) ProGT56.6 (PglD) ProGT56.7 (PglE) ProGT56.8 (PglF) ProGT56.9 (PglG) ProGT56.10 (PglK) ProGT59.1 (GalE) ProGT59.2 (GalU) ProGT59.3 (Wzm) ProGT59.4 (Wzt) ProGT59.5 (WsfA) ProGT59.6 (TagD) ProGT59.7 (WsfC) ProGT59.8 (WsfE) ProGT59.9 (RmlA) ProGT59.10 (RmlB) ProGT59.11 (RmlC) ProGT59.12 (RmlD) ProGT59.13 (WsfF) ProGT59.14 (WsfG) ProGT59.15 (WsfP) ProGT59.16 (WsfH) ProGT75.1 (Gtf3) ProGT75.2 (GlyA) ProGT75.3 (GlyB) ProGT75.4 (GlyD) ProGT75.5 (GlyE) ProGT75.6 (GlyF) ProGT75.7 (GlyG) ProGT80.1 (AglJ) ProGT80.2 (AglP) ProGT80.3 (AglQ) ProGT80.4 (AglE) ProGT80.5 (AglR) ProGT80.6 (AglF) ProGT80.7 (AglI) ProGT80.8 (AglG) ProGT80.9 (AglM) ProGT80.10 (AglD) ProGT115.1 (GT2) ProGT115.2 (GT3) ProGT120.1 (PgfM1) ProGT120.2 (PgfE) ProGT120.3 (PgfM2) ProGTNC1 (WbpO) ProGTNC2 (PglH) ProGTNC3 (WbpP) ProGTNC4 (PseB) ProGTNC5 (PseC) ProGTNC6 (PseH) ProGTNC7 (WbpA) ProGTNC8 (WbpB) ProGTNC9 (WbpE) ProGTNC10 (WbpD) ProGTNC11 (GlmU) ProGTNC12 (WbpB) ProGTNC13 (UbiA prenyltransferase) ProGTNC14 (FAD linked oxidase domain protein) ProGTNC15 (Short-chain dehydrogenase/reductase SDR) ProGTNC16 (PglD) ProGTNC17 (PglC) ProGTNC18 (PglA) ProGTNC19 (PglB) ProGTNC20 (PglE) ProGTNC21 (PglH) ProGTNC22 ProGTNC23 ProGT137.1 (GtfB) ProGT137.2 (GtfC) ProGT80.11 (Agl25) ProGT80.12 (Agl26) ProGT80.13 (Agl27) ProGT51.4 (Agl24) ProGT149.1 (GtrA) [] Compare ID ProGT1.1 (WbpM) ProGT1.2 (WbpL) ProGT9.1 (PglE) ProGT10.1 (PglH) ProGT10.2 (PglA) ProGT10.3 (PglJ) ProGT10.4 (PglI) ProGT10.5 (PglE) ProGT10.6 (PglF) ProGT10.7 (PglC) ProGT10.8 (PglD) ProGT10.9 (PglK) ProGT10.10 (PseB) ProGT10.11 (PseG) ProGT12.1 (Ppm1) ProGT13.1 (GlmS) ProGT13.2 (GlmM) ProGT13.3 (WecB) ProGT13.4 (WecC) ProGT13.5 (AglO) ProGT13.6 (AglA) ProGT13.7 (AglL) ProGT13.8 (AglH) ProGT13.9 (Agl17) ProGT13.10 (AglX) ProGT13.11 (AglY) ProGT13.12 (AglZ) ProGT13.13 (AglU) ProGT13.14 (AglV) ProGT13.15 (Agl18) ProGT13.16 (Agl19) ProGT13.17 (Agl20) ProGT13.18 (Agl21) ProGT13.19 (AglW) ProGT14.1 (Ppm1) ProGT15.1 (AglD) ProGT15.2 (AglE) ProGT15.3 (AglF) ProGT15.4 (AglG) ProGT15.5 (AglI) ProGT15.6 (AglJ) ProGT15.7 (AglM) ProGT15.8 (AglP) ProGT15.9 (AglS) ProGT15.10 (AglR) ProGT15.11 (Agl5) ProGT15.12 (Agl6) ProGT15.13 (Agl7) ProGT15.14 (Agl8) ProGT15.15 (Agl9) ProGT15.16 (Agl10) ProGT15.17 (Agl11) ProGT15.18 (Agl12) ProGT15.19 (Agl13) ProGT15.20 (Agl14) ProGT15.21 (Agl15) ProGT15.22 (AglQ) ProGT16.1 (AglA) ProGT16.2 (AglH) ProGT16.3 (AglC) ProGT16.4 (AglK) ProGT17.1 (PglB) ProGT17.2 (PglC) ProGT17.3 (PglD) ProGT17.4 (PglE) ProGT17.5 (PglF) ProGT17.6 (PglI) ProGT18.1 (PseC) ProGT18.2 (PseF) ProGT18.3 (PseI) ProGT18.4 (PseA) ProGT18.5 (PseG) ProGT18.6 (PseH) ProGT18.7 (PseB) ProGT18.8 (PseH) ProGT21.1 (PglA) ProGT21.2 (PglD) ProGT21.3 (PglF) ProGT21.4 (PgIC) ProGT21.5 (PglE) ProGT21.6 (PglI) ProGT24.1 (PglB2) ProGT24.2 (PglC) ProGT24.3 (PglD) ProGT24.4 (PglH) ProGT25.1 (PglA) ProGT25.2 (PglB2) ProGT25.3 (PglC) ProGT25.4 (PglD) ProGT25.5 (PglF) ProGT29.1 (GalT2) ProGT29.2 (Gly) ProGT33.1 (GtfC) ProGT33.2 (GtfD) ProGT33.3 (GtfE) ProGT33.4 (GtfF) ProGT33.5 (GtfG) ProGT33.6 (GtfH) ProGT35.1 (Ppm1) ProGT37.1 (Gtf3) ProGT37.2 (dGT1) ProGT42.1 (Alpha-1,6-glucosyltransferase) ProGT51.1 (Agl3) ProGT51.2 (Agl16) ProGT51.3 (AglH) ProGT54.1 (FlmA) ProGT54.2 (FlmB) ProGT54.3 (NeuA) ProGT54.4 (FlmD) ProGT54.5 (NeuB) ProGT55.1 (PglC) ProGT56.1 (PglH) ProGT56.2 (PglI) ProGT56.3 (PglJ) ProGT56.4 (PglA) ProGT56.5 (PglC) ProGT56.6 (PglD) ProGT56.7 (PglE) ProGT56.8 (PglF) ProGT56.9 (PglG) ProGT56.10 (PglK) ProGT59.1 (GalE) ProGT59.2 (GalU) ProGT59.3 (Wzm) ProGT59.4 (Wzt) ProGT59.5 (WsfA) ProGT59.6 (TagD) ProGT59.7 (WsfC) ProGT59.8 (WsfE) ProGT59.9 (RmlA) ProGT59.10 (RmlB) ProGT59.11 (RmlC) ProGT59.12 (RmlD) ProGT59.13 (WsfF) ProGT59.14 (WsfG) ProGT59.15 (WsfP) ProGT59.16 (WsfH) ProGT75.1 (Gtf3) ProGT75.2 (GlyA) ProGT75.3 (GlyB) ProGT75.4 (GlyD) ProGT75.5 (GlyE) ProGT75.6 (GlyF) ProGT75.7 (GlyG) ProGT80.1 (AglJ) ProGT80.2 (AglP) ProGT80.3 (AglQ) ProGT80.4 (AglE) ProGT80.5 (AglR) ProGT80.6 (AglF) ProGT80.7 (AglI) ProGT80.8 (AglG) ProGT80.9 (AglM) ProGT80.10 (AglD) ProGT115.1 (GT2) ProGT115.2 (GT3) ProGT120.1 (PgfM1) ProGT120.2 (PgfE) ProGT120.3 (PgfM2) ProGTNC1 (WbpO) ProGTNC2 (PglH) ProGTNC3 (WbpP) ProGTNC4 (PseB) ProGTNC5 (PseC) ProGTNC6 (PseH) ProGTNC7 (WbpA) ProGTNC8 (WbpB) ProGTNC9 (WbpE) ProGTNC10 (WbpD) ProGTNC11 (GlmU) ProGTNC12 (WbpB) ProGTNC13 (UbiA prenyltransferase) ProGTNC14 (FAD linked oxidase domain protein) ProGTNC15 (Short-chain dehydrogenase/reductase SDR) ProGTNC16 (PglD) ProGTNC17 (PglC) ProGTNC18 (PglA) ProGTNC19 (PglB) ProGTNC20 (PglE) ProGTNC21 (PglH) ProGTNC22 ProGTNC23 ProGT137.1 (GtfB) ProGT137.2 (GtfC) ProGT80.11 (Agl25) ProGT80.12 (Agl26) ProGT80.13 (Agl27) ProGT51.4 (Agl24) ProGT149.1 (GtrA) [] Compare ID ProGT1.1 (WbpM) ProGT1.2 (WbpL) ProGT9.1 (PglE) ProGT10.1 (PglH) ProGT10.2 (PglA) ProGT10.3 (PglJ) ProGT10.4 (PglI) ProGT10.5 (PglE) ProGT10.6 (PglF) ProGT10.7 (PglC) ProGT10.8 (PglD) ProGT10.9 (PglK) ProGT10.10 (PseB) ProGT10.11 (PseG) ProGT12.1 (Ppm1) ProGT13.1 (GlmS) ProGT13.2 (GlmM) ProGT13.3 (WecB) ProGT13.4 (WecC) ProGT13.5 (AglO) ProGT13.6 (AglA) ProGT13.7 (AglL) ProGT13.8 (AglH) ProGT13.9 (Agl17) ProGT13.10 (AglX) ProGT13.11 (AglY) ProGT13.12 (AglZ) ProGT13.13 (AglU) ProGT13.14 (AglV) ProGT13.15 (Agl18) ProGT13.16 (Agl19) ProGT13.17 (Agl20) ProGT13.18 (Agl21) ProGT13.19 (AglW) ProGT14.1 (Ppm1) ProGT15.1 (AglD) ProGT15.2 (AglE) ProGT15.3 (AglF) ProGT15.4 (AglG) ProGT15.5 (AglI) ProGT15.6 (AglJ) ProGT15.7 (AglM) ProGT15.8 (AglP) ProGT15.9 (AglS) ProGT15.10 (AglR) ProGT15.11 (Agl5) ProGT15.12 (Agl6) ProGT15.13 (Agl7) ProGT15.14 (Agl8) ProGT15.15 (Agl9) ProGT15.16 (Agl10) ProGT15.17 (Agl11) ProGT15.18 (Agl12) ProGT15.19 (Agl13) ProGT15.20 (Agl14) ProGT15.21 (Agl15) ProGT15.22 (AglQ) ProGT16.1 (AglA) ProGT16.2 (AglH) ProGT16.3 (AglC) ProGT16.4 (AglK) ProGT17.1 (PglB) ProGT17.2 (PglC) ProGT17.3 (PglD) ProGT17.4 (PglE) ProGT17.5 (PglF) ProGT17.6 (PglI) ProGT18.1 (PseC) ProGT18.2 (PseF) ProGT18.3 (PseI) ProGT18.4 (PseA) ProGT18.5 (PseG) ProGT18.6 (PseH) ProGT18.7 (PseB) ProGT18.8 (PseH) ProGT21.1 (PglA) ProGT21.2 (PglD) ProGT21.3 (PglF) ProGT21.4 (PgIC) ProGT21.5 (PglE) ProGT21.6 (PglI) ProGT24.1 (PglB2) ProGT24.2 (PglC) ProGT24.3 (PglD) ProGT24.4 (PglH) ProGT25.1 (PglA) ProGT25.2 (PglB2) ProGT25.3 (PglC) ProGT25.4 (PglD) ProGT25.5 (PglF) ProGT29.1 (GalT2) ProGT29.2 (Gly) ProGT33.1 (GtfC) ProGT33.2 (GtfD) ProGT33.3 (GtfE) ProGT33.4 (GtfF) ProGT33.5 (GtfG) ProGT33.6 (GtfH) ProGT35.1 (Ppm1) ProGT37.1 (Gtf3) ProGT37.2 (dGT1) ProGT42.1 (Alpha-1,6-glucosyltransferase) ProGT51.1 (Agl3) ProGT51.2 (Agl16) ProGT51.3 (AglH) ProGT54.1 (FlmA) ProGT54.2 (FlmB) ProGT54.3 (NeuA) ProGT54.4 (FlmD) ProGT54.5 (NeuB) ProGT55.1 (PglC) ProGT56.1 (PglH) ProGT56.2 (PglI) ProGT56.3 (PglJ) ProGT56.4 (PglA) ProGT56.5 (PglC) ProGT56.6 (PglD) ProGT56.7 (PglE) ProGT56.8 (PglF) ProGT56.9 (PglG) ProGT56.10 (PglK) ProGT59.1 (GalE) ProGT59.2 (GalU) ProGT59.3 (Wzm) ProGT59.4 (Wzt) ProGT59.5 (WsfA) ProGT59.6 (TagD) ProGT59.7 (WsfC) ProGT59.8 (WsfE) ProGT59.9 (RmlA) ProGT59.10 (RmlB) ProGT59.11 (RmlC) ProGT59.12 (RmlD) ProGT59.13 (WsfF) ProGT59.14 (WsfG) ProGT59.15 (WsfP) ProGT59.16 (WsfH) ProGT75.1 (Gtf3) ProGT75.2 (GlyA) ProGT75.3 (GlyB) ProGT75.4 (GlyD) ProGT75.5 (GlyE) ProGT75.6 (GlyF) ProGT75.7 (GlyG) ProGT80.1 (AglJ) ProGT80.2 (AglP) ProGT80.3 (AglQ) ProGT80.4 (AglE) ProGT80.5 (AglR) ProGT80.6 (AglF) ProGT80.7 (AglI) ProGT80.8 (AglG) ProGT80.9 (AglM) ProGT80.10 (AglD) ProGT115.1 (GT2) ProGT115.2 (GT3) ProGT120.1 (PgfM1) ProGT120.2 (PgfE) ProGT120.3 (PgfM2) ProGTNC1 (WbpO) ProGTNC2 (PglH) ProGTNC3 (WbpP) ProGTNC4 (PseB) ProGTNC5 (PseC) ProGTNC6 (PseH) ProGTNC7 (WbpA) ProGTNC8 (WbpB) ProGTNC9 (WbpE) ProGTNC10 (WbpD) ProGTNC11 (GlmU) ProGTNC12 (WbpB) ProGTNC13 (UbiA prenyltransferase) ProGTNC14 (FAD linked oxidase domain protein) ProGTNC15 (Short-chain dehydrogenase/reductase SDR) ProGTNC16 (PglD) ProGTNC17 (PglC) ProGTNC18 (PglA) ProGTNC19 (PglB) ProGTNC20 (PglE) ProGTNC21 (PglH) ProGTNC22 ProGTNC23 ProGT137.1 (GtfB) ProGT137.2 (GtfC) ProGT80.11 (Agl25) ProGT80.12 (Agl26) ProGT80.13 (Agl27) ProGT51.4 (Agl24) ProGT149.1 (GtrA) [] Compare ID ProGT1.1 (WbpM) ProGT1.2 (WbpL) ProGT9.1 (PglE) ProGT10.1 (PglH) ProGT10.2 (PglA) ProGT10.3 (PglJ) ProGT10.4 (PglI) ProGT10.5 (PglE) ProGT10.6 (PglF) ProGT10.7 (PglC) ProGT10.8 (PglD) ProGT10.9 (PglK) ProGT10.10 (PseB) ProGT10.11 (PseG) ProGT12.1 (Ppm1) ProGT13.1 (GlmS) ProGT13.2 (GlmM) ProGT13.3 (WecB) ProGT13.4 (WecC) ProGT13.5 (AglO) ProGT13.6 (AglA) ProGT13.7 (AglL) ProGT13.8 (AglH) ProGT13.9 (Agl17) ProGT13.10 (AglX) ProGT13.11 (AglY) ProGT13.12 (AglZ) ProGT13.13 (AglU) ProGT13.14 (AglV) ProGT13.15 (Agl18) ProGT13.16 (Agl19) ProGT13.17 (Agl20) ProGT13.18 (Agl21) ProGT13.19 (AglW) ProGT14.1 (Ppm1) ProGT15.1 (AglD) ProGT15.2 (AglE) ProGT15.3 (AglF) ProGT15.4 (AglG) ProGT15.5 (AglI) ProGT15.6 (AglJ) ProGT15.7 (AglM) ProGT15.8 (AglP) ProGT15.9 (AglS) ProGT15.10 (AglR) ProGT15.11 (Agl5) ProGT15.12 (Agl6) ProGT15.13 (Agl7) ProGT15.14 (Agl8) ProGT15.15 (Agl9) ProGT15.16 (Agl10) ProGT15.17 (Agl11) ProGT15.18 (Agl12) ProGT15.19 (Agl13) ProGT15.20 (Agl14) ProGT15.21 (Agl15) ProGT15.22 (AglQ) ProGT16.1 (AglA) ProGT16.2 (AglH) ProGT16.3 (AglC) ProGT16.4 (AglK) ProGT17.1 (PglB) ProGT17.2 (PglC) ProGT17.3 (PglD) ProGT17.4 (PglE) ProGT17.5 (PglF) ProGT17.6 (PglI) ProGT18.1 (PseC) ProGT18.2 (PseF) ProGT18.3 (PseI) ProGT18.4 (PseA) ProGT18.5 (PseG) ProGT18.6 (PseH) ProGT18.7 (PseB) ProGT18.8 (PseH) ProGT21.1 (PglA) ProGT21.2 (PglD) ProGT21.3 (PglF) ProGT21.4 (PgIC) ProGT21.5 (PglE) ProGT21.6 (PglI) ProGT24.1 (PglB2) ProGT24.2 (PglC) ProGT24.3 (PglD) ProGT24.4 (PglH) ProGT25.1 (PglA) ProGT25.2 (PglB2) ProGT25.3 (PglC) ProGT25.4 (PglD) ProGT25.5 (PglF) ProGT29.1 (GalT2) ProGT29.2 (Gly) ProGT33.1 (GtfC) ProGT33.2 (GtfD) ProGT33.3 (GtfE) ProGT33.4 (GtfF) ProGT33.5 (GtfG) ProGT33.6 (GtfH) ProGT35.1 (Ppm1) ProGT37.1 (Gtf3) ProGT37.2 (dGT1) ProGT42.1 (Alpha-1,6-glucosyltransferase) ProGT51.1 (Agl3) ProGT51.2 (Agl16) ProGT51.3 (AglH) ProGT54.1 (FlmA) ProGT54.2 (FlmB) ProGT54.3 (NeuA) ProGT54.4 (FlmD) ProGT54.5 (NeuB) ProGT55.1 (PglC) ProGT56.1 (PglH) ProGT56.2 (PglI) ProGT56.3 (PglJ) ProGT56.4 (PglA) ProGT56.5 (PglC) ProGT56.6 (PglD) ProGT56.7 (PglE) ProGT56.8 (PglF) ProGT56.9 (PglG) ProGT56.10 (PglK) ProGT59.1 (GalE) ProGT59.2 (GalU) ProGT59.3 (Wzm) ProGT59.4 (Wzt) ProGT59.5 (WsfA) ProGT59.6 (TagD) ProGT59.7 (WsfC) ProGT59.8 (WsfE) ProGT59.9 (RmlA) ProGT59.10 (RmlB) ProGT59.11 (RmlC) ProGT59.12 (RmlD) ProGT59.13 (WsfF) ProGT59.14 (WsfG) ProGT59.15 (WsfP) ProGT59.16 (WsfH) ProGT75.1 (Gtf3) ProGT75.2 (GlyA) ProGT75.3 (GlyB) ProGT75.4 (GlyD) ProGT75.5 (GlyE) ProGT75.6 (GlyF) ProGT75.7 (GlyG) ProGT80.1 (AglJ) ProGT80.2 (AglP) ProGT80.3 (AglQ) ProGT80.4 (AglE) ProGT80.5 (AglR) ProGT80.6 (AglF) ProGT80.7 (AglI) ProGT80.8 (AglG) ProGT80.9 (AglM) ProGT80.10 (AglD) ProGT115.1 (GT2) ProGT115.2 (GT3) ProGT120.1 (PgfM1) ProGT120.2 (PgfE) ProGT120.3 (PgfM2) ProGTNC1 (WbpO) ProGTNC2 (PglH) ProGTNC3 (WbpP) ProGTNC4 (PseB) ProGTNC5 (PseC) ProGTNC6 (PseH) ProGTNC7 (WbpA) ProGTNC8 (WbpB) ProGTNC9 (WbpE) ProGTNC10 (WbpD) ProGTNC11 (GlmU) ProGTNC12 (WbpB) ProGTNC13 (UbiA prenyltransferase) ProGTNC14 (FAD linked oxidase domain protein) ProGTNC15 (Short-chain dehydrogenase/reductase SDR) ProGTNC16 (PglD) ProGTNC17 (PglC) ProGTNC18 (PglA) ProGTNC19 (PglB) ProGTNC20 (PglE) ProGTNC21 (PglH) ProGTNC22 ProGTNC23 ProGT137.1 (GtfB) ProGT137.2 (GtfC) ProGT80.11 (Agl25) ProGT80.12 (Agl26) ProGT80.13 (Agl27) ProGT51.4 (Agl24) ProGT149.1 (GtrA) [] Search Display Criteria all All Organism Genome Information Gene Information Protein Information Glycosyltransferase Information Acceptor Subtrate Information Literature ProGT ID ProGT10.8 (PglD) Organism Information Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) Domain BacteriaClassification Phylum : ProteobacteriaClass : EpsilonproteobacteriaOrders : CampylobacteralesFamily : CampylobacteraceaeGenus : CampylobacterSpecies : jejuniSubspecies : jejuniStrain : ATCC 700819 / NCTC 11168Taxonomic ID (NCBI)192222 Genome Information Gene BankAL111168.1 EMBLAL111168.1 Gene Information Gene NamepglD NCBI Gene ID905414NCBI Reference SequenceNC_002163.1. Protein information Protein NamePglD UniProtKB/ SwissProt IDQ0P9D1 NCBI Ref SeqWP_002852865.1. UniProtKB Sequence>sp|Q0P9D1|PGLD_CAMJE UDP-N-acetylbacillosamine N-acetyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglD PE=1 SV=1 MARTEKIYIYGASGHGLVCEDVAKNMGYKECIFLDDFKGMKFESTLPKYDFFIAIGNNEI RKKIYQKISENGFKIVNLIHKSALISPSAIVEENAGILIMPYVVINAKAKIEKGVILNTS SVIEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKN QDEKGVFVGVPAKRM EMBL CDSCAL35240.1. Sequence length195 AA String192222.Cj1123c. PDB ID (Structural Information)3BSY, 2NPO, 2VHE, 3BFP, 3BSS, 3BSW, 5T2Y, 5TYH Glycosylation Information CAZY FamilyNon-GT EC Number (BRENDA)2.3.1.203 Experimental ValidationIn vitro and In vivoFunction in Glycosylation pathway1) PglD is an acetyltransferase, catalyzes the final step in the formation of Campylobacter jejuni by N-acetylation of the UDP-4-amino-sugar at the C4 position. Litrature Year Of Validation2006 Reference Olivier, N.B., Chen, M.M., Behr, J.R. and Imperiali, B., 2006. In vitro biosynthesis of UDP-N, N ‘-diacetylbacillosamine by enzymes of the Campylobacter jejuni general protein glycosylation system. Biochemistry, 45(45), pp.13659-13669.Corresponding AuthorDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.Reference Rangarajan, E.S., Ruane, K.M., Sulea, T., Watson, D.C., Proteau, A., Leclerc, S., Cygler, M., Matte, A. and Young, N.M., 2008. Structure and active site residues of PglD, an N-acetyltransferase from the bacillosamine synthetic pathway required for N-glycan synthesis in Campylobacter jejuni. Biochemistry, 47(7), pp.1827-1836.Corresponding AuthorBiotechnology Research Institute, National Research Council of Canada.Reference Rangarajan, E.S., Ruane, K.M., Sulea, T., Watson, D.C., Proteau, A., Leclerc, S., Cygler, M., Matte, A. and Young, N.M., 2008. Structure and active site residues of PglD, an N-acetyltransferase from the bacillosamine synthetic pathway required for N-glycan synthesis in Campylobacter jejuni. Biochemistry, 47(7), pp.1827-1836.Corresponding AuthorInstitute for Biological Sciences, National Research Council of Canada.Reference Reid, C.W., Stupak, J., Chen, M.M., Imperiali, B., Li, J. and Szymanski, C.M., 2008. Affinity-capture tandem mass spectrometric characterization of polyprenyl-linked oligosaccharides: tool to study protein N-glycosylation pathways. Analytical chemistry, 80(14), pp.5468-5475.Corresponding AuthorNational Research Council, Institute for Biological Sciences, 100 Sussex Drive, Ottawa, ON, Canada, K1A 0R6.Reference Reid, C.W., Stupak, J., Chen, M.M., Imperiali, B., Li, J. and Szymanski, C.M., 2008. Affinity-capture tandem mass spectrometric characterization of polyprenyl-linked oligosaccharides: tool to study protein N-glycosylation pathways. Analytical chemistry, 80(14), pp.5468-5475.Corresponding AuthorNational Research Council, Institute for Biological Sciences, 100 Sussex Drive, Ottawa, ON, Canada, K1A 0R6.