ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
Validation Status Characterized
Organism Information
Organism NamePaenibacillus (Bacillus) macerans and Bacillus amyloliquefaciens (velezensis)
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 44252
Genome Information
GenBank X55959
EMBL X55959
Protein Information
Protein NameH(A16-M) (1,3-1,4)-beta-glucanase
UniProtKB/SwissProt ID P23904
EMBL-CDSCAA39426.1
UniProtKB Sequence >sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 MKKKSCFTLVTTFAFSLIFSVSALAGSVFWEPLSYFNRSTWEKADGYSNGGVFNCTWRAN NVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGP AHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIK WYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN
Sequence length 237 AA
Subcellular LocationSecreted
Function It is the hybrid enzyme that catalyses cleavage of (1,4)-beta-linkages of O-substituted beta-D-glucanopyranosyl residues.
Protein Structure
PDB ID 1CPM, 1GLH, 2AYH
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-25) N56, N210
Experimentally Validated Glycosite(s ) in Mature ProteinN31, N185
Glycosite(s) Annotated Protein Sequence MKKKSCFTLVTTFAFSLIFSVSALAQTGGSFFEPFNSYNSGTWEKADGYSNGGVFN*(56)CTWR ANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYT GPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGY IKWYVDGVLKHTATANIPSTPGKIMMNLWN*(210)GTGVDDWLGSYNGANPLYAEYDWVKYTSN
This sequence has 16 N-terminal amino acids (colored red) derived from AMY. The remaining residues are from MAC.
Sequence Around Glycosites (21 AA) ADGYSNGGVFNCTWRANNVNF
TPGKIMMNLWNGTGVDDWLGS
ProGP Web Logo
Technique(s) used for Glycosylation DetectionMass shift detected after deglycosylation with Endo Hf and PNGase F
Technique(s) used for Glycosylated Residue(s) Detection N-terminal sequencing
Protein Glycosylation- Implication There is a large influence of N glycosylation on the thermostability of the hybrid enzyme. 16- and 133-fold decrease of thermostability has been observed after treatment with endoglycosidase H and peptide:N-glycosidase F (that remove glycans). This indicates that N-glycans are a major determinant for the resistance of this hybrid glucanase to thermal inactivation.
Glycan Information
Glycan Annotation Linkage: GlcNAc-N-Asn
Literature
Year of Identification1994
Year of Identification Month Wise1994.01.01
Year of Validation 1994
ReferenceHahn, M., Keitel, T. and Heinemann, U., 1995. Crystal and Molecular Structure at 0.16‐nm Resolution of the Hybrid Bacillus Endo‐1, 3‐1, 4‐β‐D‐Glucan 4‐Glucanohydrolase H (A16‐M). European journal of biochemistry, 232(3), pp.849-858.
ContactResearch group crystallography, Max Delbrück Center for Molecular Medicine, Berlin, Germany.
ReferenceMeldgaard, M., 1994. Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1, 3-1, 4)-β-glucanases secreted from yeast. Microbiology, 140(1), pp.159-166.
Corresponding Author M Meldgaard
ContactDepartment of Physiology, Carlsberg Laboratory, Copenhagen, Denmark.
ReferenceHahn, M., Piotukh, K., Borriss, R. and Heinemann, U., 1994. Native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis. Proceedings of the National Academy of Sciences, 91(22), pp.10417-10421.
ContactResearch group crystallography, Max Delbrück Center for Molecular Medicine, Berlin, Germany.
ReferenceKeitel, T., Meldgaard, M. and Heinemann, U., 1994. Cation binding to a Bacillus (1, 3–1, 4)‐β‐glucanase Geometry, affinity and effect on protein stability. European Journal of Biochemistry, 222(1), pp.203-214.
Corresponding Author Udo Heinemann
ContactInstitute of Crystallography, Freie Universität Berlin, Germany
ReferenceOlsen, O. and Thomsen, K.K., 1991. Improvement of bacterial β-glucanase thermostability by glycosylation. Microbiology, 137(3), pp.579-585.
Corresponding Author Karl Kristian Thomsen
ContactCarlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark
ReferenceHahn, M., Keitel, T. and Heinemann, U. (1995) Crystal and molecular structure at 0.16-nm resolution of the hybrid Bacillus endo-1,3-1,4-beta-D-glucan 4-glucanohydrolase H(A16-M). Eur J Biochem, 232, 849-858. [PubMed: 7588726]
AuthorHahn, M., Keitel, T. and Heinemann, U.
Research GroupResearch Group on Crystallography, Max Delbrück Center for Molecular Medicine, Berlin, Germany.
Corresponding Author Heinemann, U
ContactResearch Group on Crystallography, Max Delbrück Center for Molecular Medicine, Berlin, Germany.
ReferenceMeldgaard, M. and Svendsen, I. (1994) Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1,3-1,4)-beta-glucanases secreted from yeast. Microbiology, 140 ( Pt 1), 159-166. [PubMed: 8162185]
Author Meldgaard, M. Svendsen, I.
Research GroupDepartment of Physiology, Carlsberg Laboratory, Copenhagen, Denmark.
Corresponding Author Svendsen, I.
ContactDepartment of Physiology, Carlsberg Laboratory, Copenhagen, Denmark.
ReferenceHahn, M., Piotukh, K., Borriss, R. and Heinemann, U. (1994) Native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis. Proc Natl Acad Sci U S A, 91, 10417-10421. [PubMed: 7937966]
Author Hahn, M., Piotukh, K., Borriss, R. Heinemann, U.
Research GroupMax-Delbrück-Center for Molecular Medicine, Berlin, Germany.
Corresponding Author Heinemann, U.
ContactMax-Delbrück-Center for Molecular Medicine, Berlin, Germany.
ReferenceKeitel, T., Meldgaard, M. and Heinemann, U. (1994) Cation binding to a Bacillus (1,3-1,4)-beta-glucanase. Geometry, affinity and effect on protein stability. Eur J Biochem, 222, 203-214. [PubMed: 8200344]
AuthorKeitel, T., Meldgaard, M. Heinemann, U.
Research GroupInstitute of Crystallography, Freie Universität Berlin, Germany
Corresponding Author Heinemann, U.
ContactInstitute of Crystallography, Freie Universität Berlin, Germany
ReferenceOlsen, O., Thomesen, K. K. (1991) Improvement of bacterial P-glucanase thermostability by glycosylation. J Gen Microbiol, 137, 579–585.
AuthorOlsen, O., Thomesen, K. K.
Research GroupCarlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark
Corresponding Author Thomesen, K. K.
ContactCarlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark