ProGP119 (Fimbrial protein (pilin))

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP119 (Fimbrial protein (pilin))
Validation Status Characterized
Organism Information
Organism NameNeisseria gonorrhoeae N400 /MS11
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 485
Genome Information
GenBank K02078
EMBL K02078
Organism Additional Information Neisseria gonorrhoeae is the etiologic agent of the human disease gonorrhoea. It is equipped with a variety of adherence factors that help it in the colonization of diverse microenvironments in the human host. The property of phase and antigenic variation displayed by its type IV pilin enables it to avoid immune system thereby initiating the disease.
Gene Information
Gene NamepilE1
Protein Information
Protein NameFimbrial protein (pilin)
UniProtKB/SwissProt ID P02974
EMBL-CDSAAA25466.1
UniProtKB Sequence >sp|P02974|FMM1_NEIGO Fimbrial protein OS=Neisseria gonorrhoeae GN=pilE1 PE=1 SV=2 MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLN HGKWPENNTSAGVASPPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRE NGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK
Sequence length 165 AA
Subcellular LocationSurface
Function Major pilin subunit protein of the type IV pilus (Tfp) colonization factor. Type IV pili (Tfp) are proteinaceous polymeric filaments that serve critical roles in disease pathogenesis and prokaryotic cell biology in many Gram-negative species. These multifunctional virulence factors are involved in adhesion to host cell surfaces, modulation of target cell specificity, twitching motility, bacteriophage adsorption and pilus retraction.
Protein Structure
PDB ID 2HI2, 2HIL, 2PIL, 1AY2
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Propeptide: 1-7) S70
Experimentally Validated Glycosite(s ) in Mature ProteinS63
Glycosite(s) Annotated Protein Sequence >sp|P02974|FMM1_NEIGO Fimbrial protein OS=Neisseria gonorrhoeae GN=pilE1 PE=1 SV=2 MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLN HGKWPENNTS*(70)AGVASPPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRE NGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK
Sequence Around Glycosites (21 AA) NHGKWPENNTSAGVASPPSDI
Technique(s) used for Glycosylation DetectionCrystallographic analysis (electron density maps)
Technique(s) used for Glycosylated Residue(s) Detection Crystallographic analysis (electron density maps)
Protein Glycosylation- Implication Recently, using primary, human, cervical epithelial (i.e. pex) cells, pilin glycan has been shown to mediate productive cervical infection. For the first time, direct role of the protein-associated bacterial glycan in pathogenesis has been demonstrated (Ref. no. 1). Pilin glycan helps gonococci in binding to the compliment receptor 3 (CR3) I-domain expressed by pex cells when it is in a closed, low-affinity conformation. This leads to the acive state of CR3.
Glycan Information
Glycan Annotation Linkage: Bac/DATDH-Ser.
Disaccharide composed of a hexose residue linked to a proximal 2,4-diacetamido-2,4,6-trideoxyhexose sugar (HexDATDH). Various X-ray diffraction studies have identified α-D-galactopyranosyl-(1→3)-2,4-diacetamido-2,4-dideoxy-β-D-glucopyranoside (bacillosamine, Bac); Gal-DADDGlc; and GlcNAc-α1,3-Gal, as glycans. DADDGlc has a second acetamido group at C4 of the proximal glucose in place of the hydroxyl group. DADDGlc thus resembles DATDH. However, DATDH lacks the C6 hydroxyl group.
This O-linked glycan may be present as a di- or monosaccharide because of phase variation of select pilin glycosylation genes like pglA. Gal-Gal-DATDH has been shown to be present in some strains.
BCSDB ID 29194
GlyTouCan G27236WI
Technique(s) used for Glycan Identification Crystallographic analysis (electron density maps) and mass spectrometry (MS/MS)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglO
OST ProGT IDProGT21 (PglO)
Literature
ReferenceJennings, M.P., Jen, F.E.C., Roddam, L.F., Apicella, M.A. and Edwards, J.L., 2011. Neisseria gonorrhoeae pilin glycan contributes to CR3 activation during challenge of primary cervical epithelial cells. Cellular microbiology, 13(6), pp.885-896.
Corresponding Author Jennifer L. Edwards
ContactThe Center for Microbial Pathogenesis, The Research Institute at Nationwide Children's Hospital and The Department of Pediatrics, The Ohio State University, Columbus, Ohio 43205, USA
ReferenceAas, F.E., Vik, Å., Vedde, J., Koomey, M. and Egge‐Jacobsen, W., 2007. Neisseria gonorrhoeae O‐linked pilin glycosylation: functional analyses define both the biosynthetic pathway and glycan structure. Molecular microbiology, 65(3), pp.607-624.
Corresponding Author Wolfgang Egge-Jacobsen
ContactCentre for Molecular Biology and Neuroscience, Unversity of Oslo, 0316 Oslo, Norway.
ReferenceChamot-Rooke, J., Rousseau, B., Lanternier, F., Mikaty, G., Mairey, E., Malosse, C., Bouchoux, G., Pelicic, V., Camoin, L., Nassif, X. and Duménil, G., 2007. Alternative Neisseria spp. type IV pilin glycosylation with a glyceramido acetamido trideoxyhexose residue. Proceedings of the National Academy of Sciences, 104(37), pp.14783-14788.
Corresponding Author Guillaume Dumenil
ContactEcole Polytechnique, Laboratoire des Mécanismes Réactionnels, Département de Chimie, F-91128 Palaiseau, France
ReferenceCraig, L., Volkmann, N., Arvai, A.S., Pique, M.E., Yeager, M., Egelman, E.H. and Tainer, J.A., 2006. Type IV pilus structure by cryo-electron microscopy and crystallography: implications for pilus assembly and functions. Molecular cell, 23(5), pp.651-662.
Corresponding Author John A. Tainer
ContactDepartment of Molecular Biology and The Skaggs Institute for Chemical Biology, The Scripps Research Institute, La Jolla, California 92037
ReferenceHegge, F.T., Hitchen, P.G., Aas, F.E., Kristiansen, H., Løvold, C., Egge-Jacobsen, W., Panico, M., Leong, W.Y., Bull, V., Virji, M. and Morris, H.R., 2004. Unique modifications with phosphocholine and phosphoethanolamine define alternate antigenic forms of Neisseria gonorrhoeae type IV pili. Proceedings of the National Academy of Sciences, 101(29), pp.10798-10803.
Corresponding Author Michael Koomey
Contact Department of Molecular Biosciences,University of Oslo, 0316 Oslo, Norway
ReferenceForest, K.T., Dunham, S.A., Koomey, M. and Tainer, J.A., 1999. Crystallographic structure reveals phosphorylated pilin from Neisseria: phosphoserine sites modify type IV pilus surface chemistry and fibre morphology. Molecular microbiology, 31(3), pp.743-752.
Corresponding Author John A. Tainer
ContactDepartment of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037, USA.
ReferenceParge, H.E., Forest, K.T., Hickey, M.J., Christensen, D.A., Getzoff, E.D. and Tainer, J.A., 1995. Structure of the fibre-forming protein pilin at 2.6 Å resolution. Nature, 378(6552), pp.32-38.
Corresponding Author H E Parge
ContactDepartment of Molecular Biology, Scripps Research Institute, La Jolla, California 92037, USA.
ReferenceJennings, M.P., Jen, F.E., Roddam, L.F., Apicella, M.A. and Edwards, J.L. (2011) Neisseria gonorrhoeae pilin glycan contributes to CR3 activation during challenge of primary cervical epithelial cells. Cell Microbiol, 13, 885-896. [PubMed: 21371235]
AuthorJennings, M.P., Jen, F.E., Roddam, L.F., Apicella, M.A. and Edwards, J.L.
Research GroupInstitute for Glycomics, Griffith University, Gold Coast Campus, Australia.
Corresponding Author Edwards, J.L.
ContactInstitute for Glycomics, Griffith University, Gold Coast Campus, Australia.
Reference Aas, F.E., Vik, A., Vedde, J., Koomey, M. and Egge-Jacobsen, W. (2007) Neisseria gonorrhoeae O-linked pilin glycosylation: functional analyses define both the biosynthetic pathway and glycan structure. Mol Microbiol, 65, 607-624. [PubMed: 17608667]
Author Aas, F.E., Vik, A., Vedde, J., Koomey, M. and Egge-Jacobsen, W
Research GroupCentre for Molecular Biology and Neuroscience, Unversity of Oslo, 0316 Oslo, Norway
Corresponding Author Egge-Jacobsen, W
ContactCentre for Molecular Biology and Neuroscience, Unversity of Oslo, 0316 Oslo, Norway
ReferenceChamot-Rooke, J., Rousseau, B., Lanternier, F., Mikaty, G., Mairey, E., Malosse, C., Bouchoux, G., Pelicic, V., Camoin, L., Nassif, X. et al. (2007) Alternative Neisseria spp. type IV pilin glycosylation with a glyceramido acetamido trideoxyhexose residue. Proc Natl Acad Sci U S A, 104, 14783-14788. [PubMed: 17804791]
AuthorChamot-Rooke, J., Rousseau, B., Lanternier, F., Mikaty, G., Mairey, E., Malosse, C., Bouchoux, G., Pelicic, V., Camoin, L., Nassif, X. et al.
Research GroupEcole Polytechnique, Laboratory of Reaction Mechanisms, Department of Chemistry, F-91128 Palaiseau, France
Corresponding Author Duménil G.
ContactEcole Polytechnique, Laboratory of Reaction Mechanisms, Department of Chemistry, F-91128 Palaiseau, France
ReferenceCraig, L., Volkmann, N., Arvai, A.S., Pique, M.E., Yeager, M., Egelman, E.H. and Tainer, J.A. (2006) Type IV pilus structure by cryo-electron microscopy and crystallography: implications for pilus assembly and functions. Mol Cell, 23, 651-662. [PubMed: 16949362]
Author Craig, L., Volkmann, N., Arvai, A.S., Pique, M.E., Yeager, M., Egelman, E.H. Tainer, J.A.
Research GroupDepartment of Molecular Biology and Biochemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6, Canada.
Corresponding Author Tainer, J.A.
ContactDepartment of Molecular Biology and Biochemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6, Canada.
ReferenceHegge, F.T., Hitchen, P.G., Aas, F.E., Kristiansen, H., Lovold, C., Egge-Jacobsen, W., Panico, M., Leong, W.Y., Bull, V., Virji, M. et al. (2004) Unique modifications with phosphocholine and phosphoethanolamine define alternate antigenic forms of Neisseria gonorrhoeae type IV pili. Proc Natl Acad Sci U S A, 101, 10798-10803. [PubMed: 15249686]
Author Hegge, F.T., Hitchen, P.G., Aas, F.E., Kristiansen, H., Lovold, C., Egge-Jacobsen, W., Panico, M., Leong, W.Y., Bull, V., Virji, M. et al.
Research GroupCentre for Molecular Biology and Neuroscience, University of Oslo, 0316 Oslo, Norway.
Corresponding Author Michael Koomey
ContactCentre for Molecular Biology and Neuroscience, University of Oslo, 0316 Oslo, Norway.
ReferenceForest, K.T., Dunham, S.A., Koomey, M. and Tainer, J.A. (1999) Crystallographic structure reveals phosphorylated pilin from Neisseria: phosphoserine sites modify type IV pilus surface chemistry and fibre morphology. Mol Microbiol, 31, 743-752. [PubMed: 10048019]
Author Forest, K.T., Dunham, S.A., Koomey, M. and Tainer, J.A.
Research GroupDepartment of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037, USA.
Corresponding Author Tainer, J.A.
ContactDepartment of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037, USA.
ReferenceParge, H.E., Forest, K.T., Hickey, M.J., Christensen, D.A., Getzoff, E.D. and Tainer, J.A. (1995) Structure of the fibre-forming protein pilin at 2.6 A resolution. Nature, 378, 32-38. [PubMed: 7477282]
Author Parge, H.E., Forest, K.T., Hickey, M.J., Christensen, D.A., Getzoff, E.D. and Tainer, J.A.
Research GroupDepartment of Molecular Biology, Scripps Research Institute, La Jolla, California 92037, USA.
Corresponding Author Tainer, J.A.
ContactDepartment of Molecular Biology, Scripps Research Institute, La Jolla, California 92037, USA.