ProGP119 (Fimbrial protein (pilin))
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP119 (Fimbrial protein (pilin)) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Neisseria gonorrhoeae N400 /MS11 |
Domain | Bacteria |
Classification | Family: Neisseriaceae Order: Neisseriales Class: Betaproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 485 |
Genome Information | |
GenBank | K02078 |
EMBL | K02078 |
Organism Additional Information | Neisseria gonorrhoeae is the etiologic agent of the human disease gonorrhoea. It is equipped with a variety of adherence factors that help it in the colonization of diverse microenvironments in the human host. The property of phase and antigenic variation displayed by its type IV pilin enables it to avoid immune system thereby initiating the disease. |
Gene Information | |
Gene Name | pilE1 |
Protein Information | |
Protein Name | Fimbrial protein (pilin) |
UniProtKB/SwissProt ID | P02974 |
EMBL-CDS | AAA25466.1 |
UniProtKB Sequence | >sp|P02974|FMM1_NEIGO Fimbrial protein OS=Neisseria gonorrhoeae GN=pilE1 PE=1 SV=2 MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLN HGKWPENNTSAGVASPPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRE NGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK |
Sequence length | 165 AA |
Subcellular Location | Surface |
Function | Major pilin subunit protein of the type IV pilus (Tfp) colonization factor. Type IV pili (Tfp) are proteinaceous polymeric filaments that serve critical roles in disease pathogenesis and prokaryotic cell biology in many Gram-negative species. These multifunctional virulence factors are involved in adhesion to host cell surfaces, modulation of target cell specificity, twitching motility, bacteriophage adsorption and pilus retraction. |
Protein Structure | |
PDB ID | 2HI2, 2HIL, 2PIL, 1AY2 |
Glycosylation Status | |
Glycosylation Type | O- (Ser) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | (Propeptide: 1-7) S70 |
Experimentally Validated Glycosite(s ) in Mature Protein | S63 |
Glycosite(s) Annotated Protein Sequence | >sp|P02974|FMM1_NEIGO Fimbrial protein OS=Neisseria gonorrhoeae GN=pilE1 PE=1 SV=2 MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLN HGKWPENNTS*(70)AGVASPPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRE NGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK |
Sequence Around Glycosites (21 AA) | NHGKWPENNTSAGVASPPSDI |
Technique(s) used for Glycosylation Detection | Crystallographic analysis (electron density maps) |
Technique(s) used for Glycosylated Residue(s) Detection | Crystallographic analysis (electron density maps) |
Protein Glycosylation- Implication | Recently, using primary, human, cervical epithelial (i.e. pex) cells, pilin glycan has been shown to mediate productive cervical infection. For the first time, direct role of the protein-associated bacterial glycan in pathogenesis has been demonstrated (Ref. no. 1). Pilin glycan helps gonococci in binding to the compliment receptor 3 (CR3) I-domain expressed by pex cells when it is in a closed, low-affinity conformation. This leads to the acive state of CR3. |
Glycan Information | |
Glycan Annotation | Linkage: Bac/DATDH-Ser. Disaccharide composed of a hexose residue linked to a proximal 2,4-diacetamido-2,4,6-trideoxyhexose sugar (HexDATDH). Various X-ray diffraction studies have identified α-D-galactopyranosyl-(1→3)-2,4-diacetamido-2,4-dideoxy-β-D-glucopyranoside (bacillosamine, Bac); Gal-DADDGlc; and GlcNAc-α1,3-Gal, as glycans. DADDGlc has a second acetamido group at C4 of the proximal glucose in place of the hydroxyl group. DADDGlc thus resembles DATDH. However, DATDH lacks the C6 hydroxyl group. This O-linked glycan may be present as a di- or monosaccharide because of phase variation of select pilin glycosylation genes like pglA. Gal-Gal-DATDH has been shown to be present in some strains. |
BCSDB ID | 29194 |
GlyTouCan | G27236WI |
Technique(s) used for Glycan Identification | Crystallographic analysis (electron density maps) and mass spectrometry (MS/MS) |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | PglO |
OST ProGT ID | ProGT21 (PglO) |
Literature | |
Reference | Jennings, M.P., Jen, F.E.C., Roddam, L.F., Apicella, M.A. and Edwards, J.L., 2011. Neisseria gonorrhoeae pilin glycan contributes to CR3 activation during challenge of primary cervical epithelial cells. Cellular microbiology, 13(6), pp.885-896. |
Corresponding Author | Jennifer L. Edwards |
Contact | The Center for Microbial Pathogenesis, The Research Institute at Nationwide Children's Hospital and The Department of Pediatrics, The Ohio State University, Columbus, Ohio 43205, USA |
Reference | Aas, F.E., Vik, Å., Vedde, J., Koomey, M. and Egge‐Jacobsen, W., 2007. Neisseria gonorrhoeae O‐linked pilin glycosylation: functional analyses define both the biosynthetic pathway and glycan structure. Molecular microbiology, 65(3), pp.607-624. |
Corresponding Author | Wolfgang Egge-Jacobsen |
Contact | Centre for Molecular Biology and Neuroscience, Unversity of Oslo, 0316 Oslo, Norway. |
Reference | Chamot-Rooke, J., Rousseau, B., Lanternier, F., Mikaty, G., Mairey, E., Malosse, C., Bouchoux, G., Pelicic, V., Camoin, L., Nassif, X. and Duménil, G., 2007. Alternative Neisseria spp. type IV pilin glycosylation with a glyceramido acetamido trideoxyhexose residue. Proceedings of the National Academy of Sciences, 104(37), pp.14783-14788. |
Corresponding Author | Guillaume Dumenil |
Contact | Ecole Polytechnique, Laboratoire des Mécanismes Réactionnels, Département de Chimie, F-91128 Palaiseau, France |
Reference | Craig, L., Volkmann, N., Arvai, A.S., Pique, M.E., Yeager, M., Egelman, E.H. and Tainer, J.A., 2006. Type IV pilus structure by cryo-electron microscopy and crystallography: implications for pilus assembly and functions. Molecular cell, 23(5), pp.651-662. |
Corresponding Author | John A. Tainer |
Contact | Department of Molecular Biology and The Skaggs Institute for Chemical Biology, The Scripps Research Institute, La Jolla, California 92037 |
Reference | Hegge, F.T., Hitchen, P.G., Aas, F.E., Kristiansen, H., Løvold, C., Egge-Jacobsen, W., Panico, M., Leong, W.Y., Bull, V., Virji, M. and Morris, H.R., 2004. Unique modifications with phosphocholine and phosphoethanolamine define alternate antigenic forms of Neisseria gonorrhoeae type IV pili. Proceedings of the National Academy of Sciences, 101(29), pp.10798-10803. |
Corresponding Author | Michael Koomey |
Contact | Department of Molecular Biosciences,University of Oslo, 0316 Oslo, Norway |
Reference | Forest, K.T., Dunham, S.A., Koomey, M. and Tainer, J.A., 1999. Crystallographic structure reveals phosphorylated pilin from Neisseria: phosphoserine sites modify type IV pilus surface chemistry and fibre morphology. Molecular microbiology, 31(3), pp.743-752. |
Corresponding Author | John A. Tainer |
Contact | Department of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037, USA. |
Reference | Parge, H.E., Forest, K.T., Hickey, M.J., Christensen, D.A., Getzoff, E.D. and Tainer, J.A., 1995. Structure of the fibre-forming protein pilin at 2.6 Å resolution. Nature, 378(6552), pp.32-38. |
Corresponding Author | H E Parge |
Contact | Department of Molecular Biology, Scripps Research Institute, La Jolla, California 92037, USA. |
Reference | Jennings, M.P., Jen, F.E., Roddam, L.F., Apicella, M.A. and Edwards, J.L. (2011) Neisseria gonorrhoeae pilin glycan contributes to CR3 activation during challenge of primary cervical epithelial cells. Cell Microbiol, 13, 885-896. [PubMed: 21371235] |
Author | Jennings, M.P., Jen, F.E., Roddam, L.F., Apicella, M.A. and Edwards, J.L. |
Research Group | Institute for Glycomics, Griffith University, Gold Coast Campus, Australia. |
Corresponding Author | Edwards, J.L. |
Contact | Institute for Glycomics, Griffith University, Gold Coast Campus, Australia. |
Reference | Aas, F.E., Vik, A., Vedde, J., Koomey, M. and Egge-Jacobsen, W. (2007) Neisseria gonorrhoeae O-linked pilin glycosylation: functional analyses define both the biosynthetic pathway and glycan structure. Mol Microbiol, 65, 607-624. [PubMed: 17608667] |
Author | Aas, F.E., Vik, A., Vedde, J., Koomey, M. and Egge-Jacobsen, W |
Research Group | Centre for Molecular Biology and Neuroscience, Unversity of Oslo, 0316 Oslo, Norway |
Corresponding Author | Egge-Jacobsen, W |
Contact | Centre for Molecular Biology and Neuroscience, Unversity of Oslo, 0316 Oslo, Norway |
Reference | Chamot-Rooke, J., Rousseau, B., Lanternier, F., Mikaty, G., Mairey, E., Malosse, C., Bouchoux, G., Pelicic, V., Camoin, L., Nassif, X. et al. (2007) Alternative Neisseria spp. type IV pilin glycosylation with a glyceramido acetamido trideoxyhexose residue. Proc Natl Acad Sci U S A, 104, 14783-14788. [PubMed: 17804791] |
Author | Chamot-Rooke, J., Rousseau, B., Lanternier, F., Mikaty, G., Mairey, E., Malosse, C., Bouchoux, G., Pelicic, V., Camoin, L., Nassif, X. et al. |
Research Group | Ecole Polytechnique, Laboratory of Reaction Mechanisms, Department of Chemistry, F-91128 Palaiseau, France |
Corresponding Author | Duménil G. |
Contact | Ecole Polytechnique, Laboratory of Reaction Mechanisms, Department of Chemistry, F-91128 Palaiseau, France |
Reference | Craig, L., Volkmann, N., Arvai, A.S., Pique, M.E., Yeager, M., Egelman, E.H. and Tainer, J.A. (2006) Type IV pilus structure by cryo-electron microscopy and crystallography: implications for pilus assembly and functions. Mol Cell, 23, 651-662. [PubMed: 16949362] |
Author | Craig, L., Volkmann, N., Arvai, A.S., Pique, M.E., Yeager, M., Egelman, E.H. Tainer, J.A. |
Research Group | Department of Molecular Biology and Biochemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6, Canada. |
Corresponding Author | Tainer, J.A. |
Contact | Department of Molecular Biology and Biochemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6, Canada. |
Reference | Hegge, F.T., Hitchen, P.G., Aas, F.E., Kristiansen, H., Lovold, C., Egge-Jacobsen, W., Panico, M., Leong, W.Y., Bull, V., Virji, M. et al. (2004) Unique modifications with phosphocholine and phosphoethanolamine define alternate antigenic forms of Neisseria gonorrhoeae type IV pili. Proc Natl Acad Sci U S A, 101, 10798-10803. [PubMed: 15249686] |
Author | Hegge, F.T., Hitchen, P.G., Aas, F.E., Kristiansen, H., Lovold, C., Egge-Jacobsen, W., Panico, M., Leong, W.Y., Bull, V., Virji, M. et al. |
Research Group | Centre for Molecular Biology and Neuroscience, University of Oslo, 0316 Oslo, Norway. |
Corresponding Author | Michael Koomey |
Contact | Centre for Molecular Biology and Neuroscience, University of Oslo, 0316 Oslo, Norway. |
Reference | Forest, K.T., Dunham, S.A., Koomey, M. and Tainer, J.A. (1999) Crystallographic structure reveals phosphorylated pilin from Neisseria: phosphoserine sites modify type IV pilus surface chemistry and fibre morphology. Mol Microbiol, 31, 743-752. [PubMed: 10048019] |
Author | Forest, K.T., Dunham, S.A., Koomey, M. and Tainer, J.A. |
Research Group | Department of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037, USA. |
Corresponding Author | Tainer, J.A. |
Contact | Department of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037, USA. |
Reference | Parge, H.E., Forest, K.T., Hickey, M.J., Christensen, D.A., Getzoff, E.D. and Tainer, J.A. (1995) Structure of the fibre-forming protein pilin at 2.6 A resolution. Nature, 378, 32-38. [PubMed: 7477282] |
Author | Parge, H.E., Forest, K.T., Hickey, M.J., Christensen, D.A., Getzoff, E.D. and Tainer, J.A. |
Research Group | Department of Molecular Biology, Scripps Research Institute, La Jolla, California 92037, USA. |
Corresponding Author | Tainer, J.A. |
Contact | Department of Molecular Biology, Scripps Research Institute, La Jolla, California 92037, USA. |