ProGP184 (Mpt83 (Cell surface lipoprotein))
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP184 (Mpt83 (Cell surface lipoprotein)) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Mycobacterium tuberculosis |
| Domain | Bacteria |
| Classification | Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" |
| Taxonomic ID (NCBI) | 1773 |
| Genome Information | |
| GenBank | BX842581.1 |
| EMBL | BX842581 |
| Organism Additional Information | It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens. |
| Gene Information | |
| Gene Name | mpt83 (Rv2873) |
| NCBI Gene ID | 887155 |
| GenBank Gene Sequence | NC_000962.2 |
| Protein Information | |
| Protein Name | Mpt83 (Cell surface lipoprotein) |
| UniProtKB/SwissProt ID | P9WNF3 |
| NCBI RefSeq | NP_217389.1 |
| EMBL-CDS | CAA64290 |
| UniProtKB Sequence | >sp|P9WNF3|MP83_MYCTU Cell surface glycolipoprotein MPT83 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mpt83 PE=1 SV=1 MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLI GRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGG EYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADL TVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ |
| Sequence length | 220 AA |
| Subcellular Location | Membrane |
| Function | Lipoprotein |
| Glycosylation Status | |
| Technique(s) used for Glycosylation Detection | Concanavalin A (ConA) binding |
| Literature | |
| Year of Identification | 2000 |
| Year of Identification Month Wise | 2000.02 |
| Reference | González-Zamorano, M., Mendoza-Hernández, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C., 2009. Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. Journal of proteome research, 8(2), pp.721-733. |
| Corresponding Author | Clara Espitia |
| Contact | Departamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico. |
| Reference | Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D., 2000. Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. Febs Letters, 473(3), pp.358-362. |
| Corresponding Author | Jean Louis Herrmann |
| Contact | Department of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Mary's Campus, Norfolk Place, W2 1PG, London, UK |
| Reference | Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] |
| Author | Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C |
| Research Group | Department of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico. |
| Corresponding Author | Espitia, C |
| Contact | Department of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico. |
| Reference | Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240] |
| Author | Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. Young, D. |
| Research Group | Department of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London, UK |
| Corresponding Author | Young, D. |
| Contact | Department of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London, UK |