ProGP196 (ComP)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP196 (ComP)
Validation Status Uncharacterized
Organism Information
Organism NameAcinetobacter baylyi
Domain Bacteria
Classification Family: Moraxellaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 62977
Genome Information
GenBank AF012550
EMBL AF012550
Gene Information
Gene NamecomP
Protein Information
Protein NameComP
UniProtKB/SwissProt ID O30583
EMBL-CDSAAC45886.1
UniProtKB Sequence >tr|O30583|O30583_9GAMM ComP OS=Acinetobacter sp. BD413 GN=comP PE=3 SV=1 MNAQKGFTLIELMIVIAIIGILAAIAIPAYTDYTVRARVSEGLTAASSMKTTVSENILNA GALVAGTPSTAGSSCVGVQEISASNATTNVATATCGASSAGQIIVTMDTTKAKGANITLT PTYASGAVTWKCTTTSDKKYVPSECRG
Sequence length 147 AA
Subcellular LocationMembrane associated
Function This factor is essential for natural transformation of the gram-negative soil bacterium Acinetobacter sp. strain BD413
Glycosylation Status
Technique(s) used for Glycosylation DetectionDigoxigenin (DIG) labeling and detection, ZIC-HILIC for glycopeptide enrichment, multiple MS/MS fragmentation
Glycan Information
Glycan Annotation Pentasaccharide (HexNAc - HexNAc -HexNAc-HexNAc-HexNAc)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePgILcomP
OST ProGT IDProGT84 (PglLComP)
Literature
ReferenceHarding, C.M., Nasr, M.A., Kinsella, R.L., Scott, N.E., Foster, L.J., Weber, B.S., Fiester, S.E., Actis, L.A., Tracy, E.N., Munson Jr, R.S. and Feldman, M.F., 2015. A cinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O‐glycosylation of multiple proteins. Molecular microbiology, 96(5), pp.1023-1041.
Corresponding Author Mario F Feldman
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada.
ReferencePorstendörfer, D., Gohl, O., Mayer, F. and Averhoff, B., 2000. ComP, a pilin-like protein essential for natural competence in Acinetobacter sp. strain BD413: regulation, modification, and cellular localization. Journal of bacteriology, 182(13), pp.3673-3680.
Corresponding Author Beate Averhoff
ContactInstitute of Microbiology and Genetics, Georg-August-University of Göttingen, D-37077 Göttingen, Germany.
ReferenceHarding CM, Nasr MA, Kinsella RL, Scott NE, Foster LJ, Weber BS, Fiester SE, Actis LA, Tracy EN, Munson Jr RS, Feldman MF. A cinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O?glycosylation of multiple proteins. Molecular microbiology. 2015 Jun;96(5):1023-41.
AuthorHarding CM, Nasr MA, Kinsella RL, Scott NE, Foster LJ, Weber BS, Fiester SE, Actis LA, Tracy EN, Munson RS Jr, Feldman MF.
Research Group1 Center for Microbial Pathogenesis, The Research Institute at Nationwide Childrens Hospital, Columbus, OH, USA. 2 Department of Pediatrics, College of Medicine, The Ohio State University, Columbus, OH, USA. 3 Biomedical Sciences Graduate Program, College of Medicine, The Ohio State University, Columbus, OH, USA. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. 5 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 6 Department of Microbiology, Miami University, Oxford, OH, USA
Corresponding Author Feldman MF.
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada.
Reference1) Porstendorfer, D., Gohl, O., Mayer, F. and Averhoff, B. (2000) ComP, a pilin-like protein essential for natural competence in Acinetobacter sp. Strain BD413: regulation, modification, and cellular localization. J Bacteriol, 182, 3673-3680. [PubMed: 10850981]
Author Porstendorfer, D., Gohl, O., Mayer, F. Averhoff, B.
Research GroupInstitute of Microbiology and Genetics, Georg-August-University of Göttingen, D-37077 Göttingen, Germany.
Corresponding Author Averhoff, B.
ContactInstitute of Microbiology and Genetics, Georg-August-University of Göttingen, D-37077 Göttingen, Germany.