ProGP196 (ComP)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP196 (ComP) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Acinetobacter baylyi |
Domain | Bacteria |
Classification | Family: Moraxellaceae Order: Pseudomonadales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 62977 |
Genome Information | |
GenBank | AF012550 |
EMBL | AF012550 |
Gene Information | |
Gene Name | comP |
Protein Information | |
Protein Name | ComP |
UniProtKB/SwissProt ID | O30583 |
EMBL-CDS | AAC45886.1 |
UniProtKB Sequence | >tr|O30583|O30583_9GAMM ComP OS=Acinetobacter sp. BD413 GN=comP PE=3 SV=1 MNAQKGFTLIELMIVIAIIGILAAIAIPAYTDYTVRARVSEGLTAASSMKTTVSENILNA GALVAGTPSTAGSSCVGVQEISASNATTNVATATCGASSAGQIIVTMDTTKAKGANITLT PTYASGAVTWKCTTTSDKKYVPSECRG |
Sequence length | 147 AA |
Subcellular Location | Membrane associated |
Function | This factor is essential for natural transformation of the gram-negative soil bacterium Acinetobacter sp. strain BD413 |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | Digoxigenin (DIG) labeling and detection, ZIC-HILIC for glycopeptide enrichment, multiple MS/MS fragmentation |
Glycan Information | |
Glycan Annotation | Pentasaccharide (HexNAc - HexNAc -HexNAc-HexNAc-HexNAc) |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | PgILcomP |
OST ProGT ID | ProGT84 (PglLComP) |
Literature | |
Reference | Harding, C.M., Nasr, M.A., Kinsella, R.L., Scott, N.E., Foster, L.J., Weber, B.S., Fiester, S.E., Actis, L.A., Tracy, E.N., Munson Jr, R.S. and Feldman, M.F., 2015. A cinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O‐glycosylation of multiple proteins. Molecular microbiology, 96(5), pp.1023-1041. |
Corresponding Author | Mario F Feldman |
Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. |
Reference | Porstendörfer, D., Gohl, O., Mayer, F. and Averhoff, B., 2000. ComP, a pilin-like protein essential for natural competence in Acinetobacter sp. strain BD413: regulation, modification, and cellular localization. Journal of bacteriology, 182(13), pp.3673-3680. |
Corresponding Author | Beate Averhoff |
Contact | Institute of Microbiology and Genetics, Georg-August-University of Göttingen, D-37077 Göttingen, Germany. |
Reference | Harding CM, Nasr MA, Kinsella RL, Scott NE, Foster LJ, Weber BS, Fiester SE, Actis LA, Tracy EN, Munson Jr RS, Feldman MF. A cinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O?glycosylation of multiple proteins. Molecular microbiology. 2015 Jun;96(5):1023-41. |
Author | Harding CM, Nasr MA, Kinsella RL, Scott NE, Foster LJ, Weber BS, Fiester SE, Actis LA, Tracy EN, Munson RS Jr, Feldman MF. |
Research Group | 1 Center for Microbial Pathogenesis, The Research Institute at Nationwide Childrens Hospital, Columbus, OH, USA. 2 Department of Pediatrics, College of Medicine, The Ohio State University, Columbus, OH, USA. 3 Biomedical Sciences Graduate Program, College of Medicine, The Ohio State University, Columbus, OH, USA. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. 5 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 6 Department of Microbiology, Miami University, Oxford, OH, USA |
Corresponding Author | Feldman MF. |
Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. |
Reference | 1) Porstendorfer, D., Gohl, O., Mayer, F. and Averhoff, B. (2000) ComP, a pilin-like protein essential for natural competence in Acinetobacter sp. Strain BD413: regulation, modification, and cellular localization. J Bacteriol, 182, 3673-3680. [PubMed: 10850981] |
Author | Porstendorfer, D., Gohl, O., Mayer, F. Averhoff, B. |
Research Group | Institute of Microbiology and Genetics, Georg-August-University of Göttingen, D-37077 Göttingen, Germany. |
Corresponding Author | Averhoff, B. |
Contact | Institute of Microbiology and Genetics, Georg-August-University of Göttingen, D-37077 Göttingen, Germany. |