ProGP199 (Flagellin)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP199 (Flagellin) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Acidovorax avenae N1141 |
Domain | Bacteria |
Classification | Family: Comamonadaceae Order: Burkholderiales Class: Betaproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 80870 |
Genome Information | |
GenBank | AB040139 |
EMBL | AB040139 |
Organism Additional Information | Acidovorax avenae is a Gram-negative phytopathogenic bacterium. It is the causal agent of a seedling disease wherein brown stripes are formed on the sheaths of infected plants. This species has a broad host range among monocots while one or a few host species are infected by individual strains. |
Gene Information | |
Gene Name | fla1 |
Protein Information | |
Protein Name | Flagellin |
UniProtKB/SwissProt ID | Q9FAE8 |
EMBL-CDS | BAB16756.1 |
UniProtKB Sequence | >tr|Q9FAE8|Q9FAE8_9BURK Flagellin OS=Acidovorax avenae subsp. avenae GN=N1141-fla1 PE=4 SV=1 MASTINTNVSSLTAQRNLSLSQSSLNTSIQRLSSGLRINSAKDDAAGLAISERFTSQIRG LNQAVRNANDGISLAQTAEGALKSTGDILQRVRELAVQSANATNSSGDRKAIQAEVGQLL SEMDRIAGNTEFNGQKLLDGSFGSATFQVGANANQTITATTGNFRTNNYGAQLTASATGA ATTGATAGSAGAAAGTVVIAGLQTKTVNVAAAGTASDIASAVNAVADSTGVTASARNVSE MKFSGTGSFTLAVKGDNSTAANVTFNVSATSTAAGLAEAVKAFNDVSSQTGVTAKLNSDS SGLILTNESGNDINIANGSSSAAGITLASQDAVTTQSSGTLTFTSATAAGTGVTVASRGT VEYKSDKGYTVSGTGGTMTNATATSSTLTKVSDIDVSTVDGSTKALKIIDAALSAVNGQR ASFGALQSRFETTVNNLQSTSENMSASRSRIQDADFAAETANLSRSQILQQAGTAMVAQA NQLPQGVLSLLK |
Sequence length | 492 AA |
Subcellular Location | Flagellum |
Function | Flagellin is the subunit protein which polymerizes to form the filaments of flagella. |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | Higher molecular mass detected on SDS-PAGE, glycoside detection kit (Pierce) |
Literature | |
Year of Identification | 2000 |
Year of Identification Month Wise | 2000.11 |
Reference | Hirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. and Che, F.S., 2011. Glycosylation regulates specific induction of rice immune responses by Acidovorax avenae flagellin. Journal of Biological Chemistry, 286(29), pp.25519-25530. |
Corresponding Author | Fang-Sik Che |
Contact | Graduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan |
Reference | Che, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. and Isogai, A., 2000. Flagellin from an incompatible strain of Pseudomonas avenae induces a resistance response in cultured rice cells. Journal of Biological Chemistry, 275(41), pp.32347-32356. |
Corresponding Author | Fang-Sik Che |
Contact | Graduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan |
Reference | Hirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. and Che, F.S. (2011) Glycosylation regulates the specific induction of rice immune responses by Acidovorax avenae flagellin. J Biol Chem. [PubMed: 21628471] |
Author | Che, F.S. |
Research Group | Graduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan. |
Corresponding Author | Hirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. Che, F.S. |
Contact | Graduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan. |
Reference | Che, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. and Isogai, A. (2000) Flagellin from an incompatible strain of Pseudomonas avenae induces a resistance response in cultured rice cells. J Biol Chem, 275, 32347-32356. [PubMed: 10922369] |
Author | Che, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. Isogai, A. |
Research Group | Graduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5, Takayama Ikoma, Nara 630-0101, Japan. |
Corresponding Author | Isogai, A. |
Contact | Graduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5, Takayama Ikoma, Nara 630-0101, Japan. |