ProGP199 (Flagellin)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP199 (Flagellin)
Validation Status Uncharacterized
Organism Information
Organism NameAcidovorax avenae N1141
Domain Bacteria
Classification Family: Comamonadaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 80870
Genome Information
GenBank AB040139
EMBL AB040139
Organism Additional Information Acidovorax avenae is a Gram-negative phytopathogenic bacterium. It is the causal agent of a seedling disease wherein brown stripes are formed on the sheaths of infected plants. This species has a broad host range among monocots while one or a few host species are infected by individual strains.
Gene Information
Gene Namefla1
Protein Information
Protein NameFlagellin
UniProtKB/SwissProt ID Q9FAE8
EMBL-CDSBAB16756.1
UniProtKB Sequence >tr|Q9FAE8|Q9FAE8_9BURK Flagellin OS=Acidovorax avenae subsp. avenae GN=N1141-fla1 PE=4 SV=1 MASTINTNVSSLTAQRNLSLSQSSLNTSIQRLSSGLRINSAKDDAAGLAISERFTSQIRG LNQAVRNANDGISLAQTAEGALKSTGDILQRVRELAVQSANATNSSGDRKAIQAEVGQLL SEMDRIAGNTEFNGQKLLDGSFGSATFQVGANANQTITATTGNFRTNNYGAQLTASATGA ATTGATAGSAGAAAGTVVIAGLQTKTVNVAAAGTASDIASAVNAVADSTGVTASARNVSE MKFSGTGSFTLAVKGDNSTAANVTFNVSATSTAAGLAEAVKAFNDVSSQTGVTAKLNSDS SGLILTNESGNDINIANGSSSAAGITLASQDAVTTQSSGTLTFTSATAAGTGVTVASRGT VEYKSDKGYTVSGTGGTMTNATATSSTLTKVSDIDVSTVDGSTKALKIIDAALSAVNGQR ASFGALQSRFETTVNNLQSTSENMSASRSRIQDADFAAETANLSRSQILQQAGTAMVAQA NQLPQGVLSLLK
Sequence length 492 AA
Subcellular LocationFlagellum
Function Flagellin is the subunit protein which polymerizes to form the filaments of flagella.
Glycosylation Status
Technique(s) used for Glycosylation DetectionHigher molecular mass detected on SDS-PAGE, glycoside detection kit (Pierce)
Literature
Year of Identification2000
Year of Identification Month Wise2000.11
ReferenceHirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. and Che, F.S., 2011. Glycosylation regulates specific induction of rice immune responses by Acidovorax avenae flagellin. Journal of Biological Chemistry, 286(29), pp.25519-25530.
Corresponding Author Fang-Sik Che
ContactGraduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan
ReferenceChe, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. and Isogai, A., 2000. Flagellin from an incompatible strain of Pseudomonas avenae induces a resistance response in cultured rice cells. Journal of Biological Chemistry, 275(41), pp.32347-32356.
Corresponding Author Fang-Sik Che
ContactGraduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan
ReferenceHirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. and Che, F.S. (2011) Glycosylation regulates the specific induction of rice immune responses by Acidovorax avenae flagellin. J Biol Chem. [PubMed: 21628471]
Author Che, F.S.
Research GroupGraduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan.
Corresponding Author Hirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. Che, F.S.
ContactGraduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan.
ReferenceChe, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. and Isogai, A. (2000) Flagellin from an incompatible strain of Pseudomonas avenae induces a resistance response in cultured rice cells. J Biol Chem, 275, 32347-32356. [PubMed: 10922369]
AuthorChe, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. Isogai, A.
Research GroupGraduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5, Takayama Ikoma, Nara 630-0101, Japan. 
Corresponding Author Isogai, A.
ContactGraduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5, Takayama Ikoma, Nara 630-0101, Japan.