ProGP216 (BclA (collagen-like protein))
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP216 (BclA (collagen-like protein)) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Bacillus anthracis str. Ames (Sterne 7702) |
Domain | Bacteria |
Classification | Family: Bacillaceae Order: Bacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" |
Taxonomic ID (NCBI) | 1392 |
Genome Information | |
GenBank | AE016879.1 |
EMBL | AE016879 |
Organism Additional Information | Bacillus anthracis is a Gram-positive bacterium that forms spores, the causal agent of anthrax. This lethal infection involves both toxaemia and septicaemia. |
Gene Information | |
Gene Name | bclA (BA_1222) |
NCBI Gene ID | 1084744 |
GenBank Gene Sequence | NC_003997.3 |
Protein Information | |
Protein Name | BclA (collagen-like protein) |
UniProtKB/SwissProt ID | Q81JD7 |
NCBI RefSeq | NP_843695.1 |
EMBL-CDS | AAP25181.1 |
UniProtKB Sequence | >tr|Q81JD7|Q81JD7_BACAN BclA protein OS=Bacillus anthracis GN=bclA PE=1 SV=1 MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGP TGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGD TGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGP TGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGP TGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETG FYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVI VTGLGLSLALGTSASIIIEKVA |
Sequence length | 382 AA |
Subcellular Location | Surface |
Function | It is the major glycoprotein of exosporium and also the immunodominant protein of the spore surface. Exosporium is a loose fitting layer enclosing the spore. BclA forms the filaments of the external hair-like nap of the exosporium. |
Protein Structure | |
PDB ID | 2R6Q |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | ECL Glycoprotein detection kit and chemical deglycosylation using trifluoromethanesulfonic acid (TFMS). |
Glycan Information | |
Glycan Annotation | The protein is extensively O-glycosylated with a 715-Da tetrasaccharide and a 324-Da disaccharide. The tetrasaccharide contains three rhamnose residues and an unusual terminal sugar, 2-O-methyl-4- (3-hydroxy-3-methylbutanamido)-4,6-dideoxy-D-glucopyranose, named anthrose (Ant). The tetrasaccharide has the structure: β-Ant-(1→3)-α-L-Rhap-(1→3)-α-L-Rhap-(1→2)-L-Rhap. Oligosaccharide is attached to the BclA through a GalNAc linker. In its absence, GlcNAc can serve as a substitute linker. |
BCSDB ID | 23688 |
GlyTouCan | G04931OZ |
Literature | |
Year of Identification | 2002 |
Year of Identification Month Wise | 2002.7 |
Reference | Oberli, M.A., Tamborrini, M., Tsai, Y.H., Werz, D.B., Horlacher, T., Adibekian, A., Gauss, D., Möller, H.M., Pluschke, G. and Seeberger, P.H., 2010. Molecular analysis of Carbohydrate− Antibody interactions: case study using a Bacillus anthracis Tetrasaccharide. Journal of the American Chemical Society, 132(30), pp.10239-10241. |
Corresponding Author | Peter H. Seeberger |
Contact | Department of Biomolecular Systems, Max-Planck Institute for Colloids and Interfaces, 14476 Potsdam, Germany. |
Reference | Tamborrini, M., Holzer, M., Seeberger, P.H., Schürch, N. and Pluschke, G., 2010. Anthrax spore detection by a luminex assay based on monoclonal antibodies that recognize anthrose-containing oligosaccharides. Clinical and Vaccine Immunology, 17(9), pp.1446-1451. |
Corresponding Author | Marco Tamborrini |
Contact | Swiss Tropical and Public Health Institute, Socinstr. 57, CH 4002 Basel, Switzerland |
Reference | Dong, S., Chesnokova, O.N., Turnbough Jr, C.L. and Pritchard, D.G., 2009. Identification of the UDP-N-acetylglucosamine 4-epimerase involved in exosporium protein glycosylation in Bacillus anthracis. Journal of bacteriology, 191(22), pp.7094-7101. |
Corresponding Author | David G Pritchard |
Contact | Department of Biochemistry and Molecular Genetics, University of Alabama at Birmingham, Birmingham, AL 35294-2170, USA. |
Reference | Saksena, R., Adamo, R. and Kováč, P., 2006. Synthesis of the tetrasaccharide side chain of the major glycoprotein of the Bacillus anthracis exosporium. Bioorganic & medicinal chemistry letters, 16(3), pp.615-617. |
Corresponding Author | Pavol Kováč |
Contact | National Institute of Diabetes and Digestive and Kidney Disease/LMC, National Institutes of Health, Bethesda, MD 20892-0815, USA. |
Reference | Oberli, M.A., Tamborrini, M., Tsai, Y.H., Werz, D.B., Horlacher, T., Adibekian, A., Gauss, D., Moller, H.M., Pluschke, G. and Seeberger, P.H. (2010) Molecular analysis of carbohydrate-antibody interactions: case study using a Bacillus anthracis tetrasaccharide. J Am Chem Soc, 132, 10239-10241. [PubMed: 20614885] |
Author | Oberli, M.A., Tamborrini, M., Tsai, Y.H., Werz, D.B., Horlacher, T., Adibekian, A., Gauss, D., Moller, H.M., Pluschke, G. Seeberger, P.H. |
Research Group | Department of Biomolecular Systems, Max-Planck Institute for Colloids and Interfaces, 14476 Potsdam, Germany. |
Corresponding Author | Seeberger, P.H. |
Contact | Department of Biomolecular Systems, Max-Planck Institute for Colloids and Interfaces, 14476 Potsdam, Germany. |
Reference | Tamborrini, M., Holzer, M., Seeberger, P.H., Schurch, N. and Pluschke, G. (2010) Anthrax spore detection by a luminex assay based on monoclonal antibodies that recognize anthrose-containing oligosaccharides. Clin Vaccine Immunol, 17, 1446-1451. [PubMed: 20660139] |
Author | Tamborrini, M., Holzer, M., Seeberger, P.H., Schurch, N. Pluschke, G. |
Research Group | Swiss Tropical and Public Health Institute, Socinstr. 57, CH 4002 Basel, Switzerland |
Corresponding Author | Pluschke, G. |
Contact | Swiss Tropical and Public Health Institute, Socinstr. 57, CH 4002 Basel, Switzerland |
Reference | Dong, S., Chesnokova, O.N., Turnbough, C.L., Jr. and Pritchard, D.G. (2009) Identification of the UDP-N-acetylglucosamine 4-epimerase involved in exosporium protein glycosylation in Bacillus anthracis. J Bacteriol, 191, 7094-7101. [PubMed: 19749053] |
Author | Dong, S., Chesnokova, O.N., Turnbough, C.L., Jr. Pritchard, D.G. |
Research Group | Department of Biochemistry and Molecular Genetics, University of Alabama at Birmingham, Birmingham, AL 35294-2170, USA. |
Corresponding Author | Pritchard, D.G. |
Contact | Department of Biochemistry and Molecular Genetics, University of Alabama at Birmingham, Birmingham, AL 35294-2170, USA. |
Reference | Saksena, R., Adamo, R. and Kovac, P. (2006) Synthesis of the tetrasaccharide side chain of the major glycoprotein of the Bacillus anthracis exosporium. Bioorg Med Chem Lett, 16, 615-617. [PubMed: 16275067] |
Author | Saksena, R., Adamo, R. and Kovac, P |
Research Group | National Institute of Diabetes and Digestive and Kidney Disease/LMC, National Institutes of Health, Bethesda, MD 20892-0815, USA. |
Corresponding Author | Kovac, P |
Contact | National Institute of Diabetes and Digestive and Kidney Disease/LMC, National Institutes of Health, Bethesda, MD 20892-0815, USA. |