ProGP221 (Cj1496c)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP221 (Cj1496c) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Campylobacter jejuni NCTC 11168 serotype O:2 |
Domain | Bacteria |
Classification | Family: Campylobacteraceae Order: Campylobacterales Class: Epsilonproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 192222 |
Genome Information | |
GenBank | AL111168.1 |
EMBL | AL111168 |
Organism Additional Information | Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity. |
Gene Information | |
Gene Name | Cj1496c |
NCBI Gene ID | 906007 |
GenBank Gene Sequence | NC_002163 |
Protein Information | |
Protein Name | Cj1496c |
UniProtKB/SwissProt ID | Q0P8C1 |
NCBI RefSeq | YP_002344876.1 |
EMBL-CDS | CAL35603.1 |
UniProtKB Sequence | >tr|Q0P8C1|Q0P8C1_CAMJE Putative periplasmic protein OS=Campylobacter jejuni GN=Cj1496c PE=1 SV=1 MIKKFILLVFISSVVFGAEQDCEQYFEARKAQIELQTREFDEARQSLEAYKASFEALQKE RLENLEKKEAEVNATLAKIEELKLENARLVEEQQKILNSINDKTQGRVKEIYSQMKDAAI ADVLSQMDAEDASKIMLSLESRKISGVLSKMDPKKASELTLLLKNLDNNASN |
Sequence length | 172 AA |
Subcellular Location | Priplasm |
Function | Required for the attachment and/or invasion to INT-407 intestinal epithelial cells and the colonization of the chick gastrointestinal tract. |
Glycosylation Status | |
Glycosylation Type | N- (Asn) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | N73, N169 |
Experimentally Validated Glycosite(s ) in Mature Protein | N73, N169 |
Glycosite(s) Annotated Protein Sequence | >tr|Q0P8C1|Q0P8C1_CAMJE Putative periplasmic protein OS=Campylobacter jejuni GN=Cj1496c PE=1 SV=1 MIKKFILLVFISSVVFGAEQDCEQYFEARKAQIELQTREFDEARQSLEAYKASFEALQKE RLENLEKKEAEVN*(73)ATLAKIEELKLENARLVEEQQKILNSINDKTQGRVKEIYSQMKDAAI ADVLSQMDAEDASKIMLSLESRKISGVLSKMDPKKASELTLLLKNLDNN*(169)ASN |
Sequence Around Glycosites (21 AA) | ENLEKKEAEVNATLAKIEELK
LTLLLKNLDNNASN |
Technique(s) used for Glycosylation Detection | SBA (soybean agglutinin) lectin-agarose affinity chromatography |
Technique(s) used for Glycosylated Residue(s) Detection | Site-specific mutagenesis combined with Western blot analysis |
Protein Glycosylation- Implication | Glycans are not directly involved in the function of Cj1496c. |
Glycan Information | |
Glycan Annotation | Linkage: Bac-Asn. 1406 Da heptasaccharide composed of GalNAc-?1,4-GalNAc-?1,4-[Glc?1,3-]GalNAc-?1,4-GalNAc-?1,4-GalNAc-?1,3-Bac-?1,N-Asn-Xaa, where Bac is bacillosamine, 2,4-diacetamido-2,4,6-trideoxyglucopyranose. |
BCSDB ID | 23625 |
GlyTouCan | G58528CE |
Technique(s) used for Glycan Identification | 1H, 13C NMR spectroscopy- one dimensional TOCSY (total correlation spectroscopy) and NOESY (nuclear Overhauser effect spectroscopy); HMBC (heteronuclear multiple bond coherence), HMQC (heteronuclear multiple quantum correlation) spectra. |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | PglB |
OST ProGT ID | ProGT10 (PglB) |
Literature | |
Reference | Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J. and Kohda, D. (2010) Comparative structural biology of eubacterial and archaeal oligosaccharyltransferases. J Biol Chem, 285, 4941-4950. [PubMed: 20007322] |
Author | Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J. and Kohda, D. |
Research Group | Institute of Microbiology, Department of Biology, Swiss Federal Institute of Technology Zurich, ETH Hönggerberg, Switzerland. |
Corresponding Author | Kohda, D |
Contact | Institute of Microbiology, Department of Biology, Swiss Federal Institute of Technology Zurich, ETH Hönggerberg, Switzerland. |
Reference | Kakuda, T. and DiRita, V.J. (2006) Cj1496c encodes a Campylobacter jejuni glycoprotein that influences invasion of human epithelial cells and colonization of the chick gastrointestinal tract. Infect Immun, 74, 4715-4723. [PubMed: 16861659] |
Author | Kakuda, T. DiRita, V.J. |
Research Group | Unit for Laboratory Animal Medicine and Department of Microbiology and Immunology, University of Michigan Medical School, Ann Arbor, Michigan 48109, USA. |
Corresponding Author | DiRita, V.J. |
Contact | Unit for Laboratory Animal Medicine and Department of Microbiology and Immunology, University of Michigan Medical School, Ann Arbor, Michigan 48109, USA. |
Reference | Olivier, N.B., Chen, M.M., Behr, J.R. and Imperiali, B. (2006) In vitro biosynthesis of UDP-N,N-diacetylbacillosamine by enzymes of the Campylobacter jejuni general protein glycosylation system. Biochemistry, 45, 13659-13669. [PubMed: 17087520] |
Author | Olivier, N.B., Chen, M.M., Behr, J.R. Imperiali, B. |
Research Group | Department of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA. |
Corresponding Author | Imperiali, B. |
Contact | Department of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA. |
Reference | Young, N.M., Brisson, J.R., Kelly, J., Watson, D.C., Tessier, L., Lanthier, P.H., Jarrell, H.C., Cadotte, N., St Michael, F., Aberg, E. et al. (2002) Structure of the N-linked glycan present on multiple glycoproteins in the Gram-negative bacterium, Campylobacter jejuni. J Biol Chem, 277, 42530-42539. [PubMed: 12186869] |
Author | Yurist-Doutsch, S., Magidovich, H., Ventura, V.V., Hitchen, P.G., Dell, A. and Eichler, J |
Research Group | Institute for Biological Sciences, National Research Council of Canada, 100 Sussex Dr., Ottawa, Ontario K1A 0R6, Canada |
Corresponding Author | N. Martin Young |
Contact | Institute for Biological Sciences, National Research Council of Canada, 100 Sussex Dr., Ottawa, Ontario K1A 0R6, Canada |
Reference | Scott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ. (2011) Simultaneous glycan-peptide characterization using hydrophilic interaction chromatography and parallel fragmentation by CID, higher energy collisional dissociation, and electron transfer dissociation MS applied to the N-linked glycoproteome of Campylobacter jejuni. Mol Cell Proteomics, 10(2), M000031-MCP201. [PubMed: 20360033] |
Author | Scott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ |
Research Group | School of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia |
Corresponding Author | Cordwell SJ |
Contact | School of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia |