ProGP222 (PEB3)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP222 (PEB3) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Campylobacter jejuni NCTC 11168 serotype O:2 |
| Domain | Bacteria |
| Classification | Family: Campylobacteraceae Order: Campylobacterales Class: Epsilonproteobacteria Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 192222 |
| Genome Information | |
| GenBank | AL111168.1 |
| EMBL | AL111168 |
| Organism Additional Information | Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity. |
| Gene Information | |
| Gene Name | Cj0289c |
| NCBI Gene ID | 904613 |
| GenBank Gene Sequence | NC_002163 |
| Protein Information | |
| Protein Name | PEB3 |
| UniProtKB/SwissProt ID | Q0PBL7 |
| NCBI RefSeq | YP_002343730.1 |
| EMBL-CDS | CAL34442.1 |
| UniProtKB Sequence | >tr|Q0PBL7|Q0PBL7_CAMJE Major antigenic peptide PEB3 OS=Campylobacter jejuni GN=peb3 PE=1 SV=1 MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWF EKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDL ANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQ DQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAK EIFKKYGWRE |
| Sequence length | 250 AA |
| Subcellular Location | Surface |
| Function | Functions as an adhesin ; also a transport protein that may function in utilization of 3-phosphoglycerate or other phosphate-containing molecules from the host. |
| Protein Structure | |
| PDB ID | 2HXW |
| Glycosylation Status | |
| Glycosylation Type | N- (Asn) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | N90 |
| Experimentally Validated Glycosite(s ) in Mature Protein | N90 |
| Glycosite(s) Annotated Protein Sequence | >tr|Q0PBL7|Q0PBL7_CAMJE Major antigenic peptide PEB3 OS=Campylobacter jejuni GN=peb3 PE=1 SV=1 MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWF EKAKKDADILFGASDQSALAIASDFGKDFN*(90)VSKIKPLYFREAIILTQKGNPLKIKGLKDL ANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQ DQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAK EIFKKYGWRE |
| Sequence Around Glycosites (21 AA) | AIASDFGKDFNVSKIKPLYFR |
| Technique(s) used for Glycosylation Detection | SBA (soybean agglutinin) lectin-agarose affinity chromatography |
| Technique(s) used for Glycosylated Residue(s) Detection | CapLC-MS/MS (capillary liquid chromatography-tandem mass spectrometry) |
| Glycan Information | |
| Glycan Annotation | Linkage: Bac-Asn. 1406 Da heptasaccharide composed of GalNAc-?1,4-GalNAc-?1,4-[Glc?1,3-]GalNAc-?1,4-GalNAc-?1,4-GalNAc-?1,3-Bac-?1,N-Asn-Xaa, where Bac is bacillosamine, 2,4-diacetamido-2,4,6-trideoxyglucopyranose. |
| BCSDB ID | 23625 |
| GlyTouCan | G58528CE |
| Technique(s) used for Glycan Identification | 1H, 13C NMR spectroscopy- one dimensional TOCSY (total correlation spectroscopy) and NOESY (nuclear Overhauser effect spectroscopy); HMBC (heteronuclear multiple bond coherence), HMQC (heteronuclear multiple quantum correlation) spectra. |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PglB |
| OST ProGT ID | ProGT10 (PglB) |
| Literature | |
| Reference | Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J. and Kohda, D. (2010) Comparative structural biology of eubacterial and archaeal oligosaccharyltransferases. J Biol Chem, 285, 4941-4950. [PubMed: 20007322] |
| Author | Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J. and Kohda, D. |
| Research Group | Institute of Microbiology, Department of Biology, Swiss Federal Institute of Technology Zurich, ETH Hönggerberg, Switzerland. |
| Corresponding Author | Kohda, D |
| Contact | Institute of Microbiology, Department of Biology, Swiss Federal Institute of Technology Zurich, ETH Hönggerberg, Switzerland. |
| Reference | Rangarajan, E.S., Bhatia, S., Watson, D.C., Munger, C., Cygler, M., Matte, A. and Young, N.M. (2007) Structural context for protein N-glycosylation in bacteria: The structure of PEB3, an adhesin from Campylobacter jejuni. Protein Sci, 16, 990-995. [PubMed: 17456748] |
| Author | Rangarajan, E.S., Bhatia, S., Watson, D.C., Munger, C., Cygler, M., Matte, A. Young, N.M. |
| Research Group | Department of Biochemistry, McGill University, Montreal, Quebec H3G 1Y6, Canada. |
| Corresponding Author | Young, N.M. |
| Contact | Department of Biochemistry, McGill University, Montreal, Quebec H3G 1Y6, Canada. |
| Reference | Olivier, N.B., Chen, M.M., Behr, J.R. and Imperiali, B. (2006) In vitro biosynthesis of UDP-N,N-diacetylbacillosamine by enzymes of the Campylobacter jejuni general protein glycosylation system. Biochemistry, 45, 13659-13669. [PubMed: 17087520] |
| Author | Olivier, N.B., Chen, M.M., Behr, J.R. Imperiali, B. |
| Research Group | Department of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA. |
| Corresponding Author | Imperiali, B. |
| Contact | Department of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA. |
| Reference | Linton, D., Allan, E., Karlyshev, A.V., Cronshaw, A.D. and Wren, B.W. (2002) Identification of N-acetylgalactosamine-containing glycoproteins PEB3 and CgpA in Campylobacter jejuni. Mol Microbiol, 43, 497-508. [PubMed: 11985725] |
| Author | Linton, D., Allan, E., Karlyshev, A.V., Cronshaw, A.D. Wren, B.W. |
| Research Group | Department of Infectious and Tropical Diseases, |
| Corresponding Author | Wren, B.W. |
| Contact | Department of Infectious and Tropical Diseases, |
| Reference | Young, N.M., Brisson, J.R., Kelly, J., Watson, D.C., Tessier, L., Lanthier, P.H., Jarrell, H.C., Cadotte, N., St Michael, F., Aberg, E. et al. (2002) Structure of the N-linked glycan present on multiple glycoproteins in the Gram-negative bacterium, Campylobacter jejuni. J Biol Chem, 277, 42530-42539. [PubMed: 12186869] |
| Author | Young, N.M., Brisson, J.R., Kelly, J., Watson, D.C., Tessier, L., Lanthier, P.H., Jarrell, H.C., Cadotte, N., St Michael, F., Aberg, E. et al. |
| Research Group | Institute for Biological Sciences, National Research Council of Canada, 100 Sussex Dr., Ottawa, Ontario K1A 0R6, Canada. |
| Corresponding Author | Young, N.M,St Michael, |
| Contact | Institute for Biological Sciences, National Research Council of Canada, 100 Sussex Dr., Ottawa, Ontario K1A 0R6, Canada. |
| Reference | Scott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ. (2011) Simultaneous glycan-peptide characterization using hydrophilic interaction chromatography and parallel fragmentation by CID, higher energy collisional dissociation, and electron transfer dissociation MS applied to the N-linked glycoproteome of Campylobacter jejuni. Mol Cell Proteomics, 10(2), M000031-MCP201. [PubMed: 20360033] |
| Author | Scott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ |
| Research Group | School of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia |
| Corresponding Author | Cordwell SJ |
| Contact | School of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia |