ProGP23 (Flagellin FlaB2)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP23 (Flagellin FlaB2) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Treponema pallidum subsp. pallidum Nichols |
Domain | Bacteria |
Classification | Family: Spirochaetaceae Order: Spirochaetales Class: Spirochaetes Division or phylum: "Spirochaetes" or "Spirochaetae" |
Taxonomic ID (NCBI) | 160 |
Genome Information | |
GenBank | AE000520.1 |
EMBL | AE000520 |
Gene Information | |
Gene Name | flaB2 (TP_0792) |
NCBI Gene ID | 2610779 |
GenBank Gene Sequence | NC_000919.1 |
Protein Information | |
Protein Name | Flagellin FlaB2 |
UniProtKB/SwissProt ID | P21991 |
NCBI RefSeq | NP_219229.1 |
EMBL-CDS | AAC65757.1 |
UniProtKB Sequence | >sp|P21991|FLAB2_TREPA Flagellar filament 33 kDa core protein OS=Treponema pallidum GN=flaB2 PE=1 SV=2 MIINHNMSAMFSQRTLGHTNLSVQKNIEKLSSGLRINRSGDDASGLAVSEKMRSQIRGLN QASTNAQNGISFIQVAEAFLQETTDVIQRIRELSVQAANGIYSAEDRLYIQVEVSQLVAE VDRIASHAQFNGMNMLTGRFARQGGENTVTASMWFHIGANMDQRTRAYIGTMTAVAMGIR DAGDESVMNIDSPEKANRAIGTLDQAIKRINKQRADLGAYQNRLDHTVAGINVAAENLQA AESRIRDVDMAKEMVDYTKNQILVQSGTAMLAQANQATQSVLSLLR |
Sequence length | 286 AA |
Subcellular Location | Periplasm |
Function | Flagellar 33 kDa core protein. It is the major component of the endoflagella which are required for motility of Treponemes. |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | Intrinsic [14C]glucosamine-labeling, periodate oxidation-DIG (digoxigenin) hydrazide labeling |
Literature | |
Year of Identification | 1984 |
Year of Identification Month Wise | 1984.2 |
Reference | Wyss, C., 1998. Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infection and immunity, 66(12), pp.5751-5754. |
Corresponding Author | C. Wyss |
Contact | Institute for Oral Microbiology and General Immunology, Center for Dentistry, Oral and Maxillofacial Medicine at the University of Zurich, CH-8028 Zurich, Switzerland. |
Reference | Moskophidis, M. and Müller, F., 1985. Identification of glycosylated protein antigens of Treponema pallidum and Treponema phagedenis. Zentralblatt für Bakteriologie, Mikrobiologie und Hygiene. Series A: Medical Microbiology, Infectious Diseases, Virology, Parasitology, 259(4), pp.468-476. |
Corresponding Author | Ferdinand Muller |
Contact | From the Department of Medicine, School of Medicine, University of Washington, Seattle, |
Reference | Moskophidis, M.A.T.T.H.A.U.S. and Müller, F., 1984. Molecular characterization of glycoprotein antigens on surface of Treponema pallidum: comparison with nonpathogenic Treponema phagedenis biotype Reiter. Infection and immunity, 46(3), pp.867-869. |
Corresponding Author | Ferdinand Muller |
Contact | From the Department of Medicine, School of Medicine, University of Washington, Seattle, |
Reference | Wyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350] |
Author | Wyss, C. |
Research Group | Institute of Oral Microbiology and General Immunology, Center for Dental, Oral and Maxillofacial Surgery, University of Zurich, CH-8028 Zurich, Switzerland. |
Corresponding Author | Wyss, C. |
Contact | Institute of Oral Microbiology and General Immunology, Center for Dental, Oral and Maxillofacial Surgery, University of Zurich, CH-8028 Zurich, Switzerland. |
Reference | Moskophidis, M. and Muller, F. (1985) Identification of glycosylated protein antigens of Treponema pallidum and Treponema phagedenis. Zentralbl Bakteriol Mikrobiol Hyg A, 259, 468-476. [PubMed: 3901616] |
Author | Moskophidis, M. Muller, F. |
Research Group | Department of Medicine, School of Medicine, University of Washington, Seattle, |
Corresponding Author | Muller, F. |
Contact | Department of Medicine, School of Medicine, University of Washington, Seattle, |
Reference | Moskophidis M, Müller F.(1984) Molecular characterization of glycoprotein antigens on surface of Treponema pallidum: comparison with nonpathogenic Treponema phagedenis biotype Reiter. Infect Immun., 46(3), 867-9. [PubMed: 6389370] |
Author | Moskophidis, M. Muller, F. |
Corresponding Author | Muller, F. |