ProGP23 (Flagellin FlaB2)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP23 (Flagellin FlaB2)
Validation Status Uncharacterized
Organism Information
Organism NameTreponema pallidum subsp. pallidum Nichols
Domain Bacteria
Classification Family: Spirochaetaceae
Order: Spirochaetales
Class: Spirochaetes
Division or phylum: "Spirochaetes" or "Spirochaetae"
Taxonomic ID (NCBI) 160
Genome Information
GenBank AE000520.1
EMBL AE000520
Gene Information
Gene NameflaB2 (TP_0792)
NCBI Gene ID 2610779
GenBank Gene Sequence NC_000919.1
Protein Information
Protein NameFlagellin FlaB2
UniProtKB/SwissProt ID P21991
NCBI RefSeq NP_219229.1
EMBL-CDSAAC65757.1
UniProtKB Sequence >sp|P21991|FLAB2_TREPA Flagellar filament 33 kDa core protein OS=Treponema pallidum GN=flaB2 PE=1 SV=2 MIINHNMSAMFSQRTLGHTNLSVQKNIEKLSSGLRINRSGDDASGLAVSEKMRSQIRGLN QASTNAQNGISFIQVAEAFLQETTDVIQRIRELSVQAANGIYSAEDRLYIQVEVSQLVAE VDRIASHAQFNGMNMLTGRFARQGGENTVTASMWFHIGANMDQRTRAYIGTMTAVAMGIR DAGDESVMNIDSPEKANRAIGTLDQAIKRINKQRADLGAYQNRLDHTVAGINVAAENLQA AESRIRDVDMAKEMVDYTKNQILVQSGTAMLAQANQATQSVLSLLR
Sequence length 286 AA
Subcellular LocationPeriplasm
Function Flagellar 33 kDa core protein. It is the major component of the endoflagella which are required for motility of Treponemes.
Glycosylation Status
Technique(s) used for Glycosylation DetectionIntrinsic [14C]glucosamine-labeling, periodate oxidation-DIG (digoxigenin) hydrazide labeling
Literature
Year of Identification1984
Year of Identification Month Wise1984.2
ReferenceWyss, C., 1998. Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infection and immunity, 66(12), pp.5751-5754.
Corresponding Author C. Wyss
ContactInstitute for Oral Microbiology and General Immunology, Center for Dentistry, Oral and Maxillofacial Medicine at the University of Zurich, CH-8028 Zurich, Switzerland.
ReferenceMoskophidis, M. and Müller, F., 1985. Identification of glycosylated protein antigens of Treponema pallidum and Treponema phagedenis. Zentralblatt für Bakteriologie, Mikrobiologie und Hygiene. Series A: Medical Microbiology, Infectious Diseases, Virology, Parasitology, 259(4), pp.468-476.
Corresponding Author Ferdinand Muller
ContactFrom the Department of Medicine, School of Medicine, University of Washington, Seattle,
ReferenceMoskophidis, M.A.T.T.H.A.U.S. and Müller, F., 1984. Molecular characterization of glycoprotein antigens on surface of Treponema pallidum: comparison with nonpathogenic Treponema phagedenis biotype Reiter. Infection and immunity, 46(3), pp.867-869.
Corresponding Author Ferdinand Muller
ContactFrom the Department of Medicine, School of Medicine, University of Washington, Seattle,
ReferenceWyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350]
AuthorWyss, C.
Research GroupInstitute of Oral Microbiology and General Immunology, Center for Dental, Oral and Maxillofacial Surgery, University of Zurich, CH-8028 Zurich, Switzerland.
Corresponding Author Wyss, C.
ContactInstitute of Oral Microbiology and General Immunology, Center for Dental, Oral and Maxillofacial Surgery, University of Zurich, CH-8028 Zurich, Switzerland.
ReferenceMoskophidis, M. and Muller, F. (1985) Identification of glycosylated protein antigens of Treponema pallidum and Treponema phagedenis. Zentralbl Bakteriol Mikrobiol Hyg A, 259, 468-476. [PubMed: 3901616]
AuthorMoskophidis, M. Muller, F.
Research GroupDepartment of Medicine, School of Medicine, University of Washington, Seattle,
Corresponding Author Muller, F.
ContactDepartment of Medicine, School of Medicine, University of Washington, Seattle,
ReferenceMoskophidis M, Müller F.(1984) Molecular characterization of glycoprotein antigens on surface of Treponema pallidum: comparison with nonpathogenic Treponema phagedenis biotype Reiter. Infect Immun., 46(3), 867-9. [PubMed: 6389370]
AuthorMoskophidis, M. Muller, F.
Corresponding Author Muller, F.