ProGP230 (PilA (Type IV pilin))

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP230 (PilA (Type IV pilin))
Validation Status Characterized
Organism Information
Organism NamePseudomonas aeruginosa Pa5196
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 287
Genome Information
GenBank AY112720
EMBL AY112720
Organism Additional Information This Gram-negative opportunistic pathogen is responsible for nosocomial pneumonia. It possesses a multitude of virulence factors including type IV pili that mediate adhesion to host cells. It is also the major cause of mortality among cystic fibrosis (CF) patients.
Gene Information
Gene NamepilA
Protein Information
Protein NamePilA (Type IV pilin)
UniProtKB/SwissProt ID Q8KQ32
EMBL-CDSAAM52059.1
UniProtKB Sequence >tr|Q8KQ32|Q8KQ32_PSEAE Type IV pilin structural subunit OS=Pseudomonas aeruginosa GN=pilA PE=3 SV=1 MKAQKGFTLIELMIVVAIIGILAAVAIPAYQDYITRGQVTEAVSLGGGLKSPLAEYGADK NAWPTLVAPTATPGAGQLNATLVGKYSSVDSTIASGYPNGQITVTMTQGKASGKKLTFST QDGGSSWACGNASIDGFAGTGTTIDAKYLPNACKP
Sequence length 155 AA
Subcellular LocationSurface
Function Structural unit of the pili that have a role in adherence (colonization of both living and non-living surfaces) and twitching motility. These colonization factors (type IV pili) are also involved in biofilm formation.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Propeptide: 1-6) T70, T72, S87, S88, S91, S95
Experimentally Validated Glycosite(s ) in Mature ProteinT64, T66, S81, S82, S85, S89
Glycosite(s) Annotated Protein Sequence >tr|Q8KQ32|Q8KQ32_PSEAE Type IV pilin structural subunit OS=Pseudomonas aeruginosa GN=pilA PE=3 SV=1 MKAQKGFTLIELMIVVAIIGILAAVAIPAYQDYITRGQVTEAVSLGGGLKSPLAEYGADK NAWPTLVAPT*(70)AT*(72)PGAGQLNATLVGKYS*(87)S*(88)VDS*(91)TIAS*(95)GYPNGQITVTMTQGKASGKKLTFST QDGGSSWACGNASIDGFAGTGTTIDAKYLPNACKP
Sequence Around Glycosites (21 AA) KNAWPTLVAPTATPGAGQLNA
AWPTLVAPTATPGAGQLNATL
QLNATLVGKYSSVDSTIASGY
LNATLVGKYSSVDSTIASGYP
TLVGKYSSVDSTIASGYPNGQ
KYSSVDSTIASGYPNGQITVT
ProGP Web Logo
Technique(s) used for Glycosylation DetectionSlower migration on SDS-PAGE than its predicted mass and staining with GlycoPro?le III ?uorescent-glycoprotein detection kit
Technique(s) used for Glycosylated Residue(s) Detection Validation of T70 and T72 glycosylated sites using site-directed mutagenesis and ETD-MS (electron transfer dissociation mass spectrometry). Rest of the sites were determined by a combination of nano-liquid chromatography-tandem mass spectrometry (nano-LC-MS/MS) and nESI-MS/MS with front-end-collision induced dissociation (nESI-feCID-MS/MS).
Protein Glycosylation- Implication Modifications of αβ-loop residues Thr64 and Thr66 are important for normal pilus assembly or extension/retraction dynamics. The Thr64Ala and Thr66Ala single and double mutants, as well as the nonglycosylated tfpW mutant, had fewer surface pili and reduced motility compared with the wild type.
Glycan Information
Glycan Annotation Linkages: FucNAc-Ser.
Unusual homooligomers of α-1,5-linked D-arabinofuranose (α-1,5-D-Araf). Oligomer length varies from 3 to 8 units with an average length of 6 units. Trisaccharides of α-1,5-D-Araf are the principal modifications at Thr64 and Thr66, with additional mono- and disaccharides identified on Ser residues.
The pilin glycan is antigenically and chemically identical to that of Mycobacterium.
Microheterogeneity in glycosylation is observed.
BCSDB ID 20019
GlyTouCan G30321MJ
Technique(s) used for Glycan Identification NMR spectroscopy including 1H-13C HSQC (heteronuclear single-quantum coherence) and 1H-13C HMBC (heteronuclear multiple bond coherence) and, chirality of glycans identified by GC-MS (gas chromatography-mass spectrometry).
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameTfpW (arabinosyltransferase)
OST ProGT IDProGT26 (TfpW)
Literature
ReferenceKus, J.V., Kelly, J., Tessier, L., Harvey, H., Cvitkovitch, D.G. and Burrows, L.L., 2008. Modification of Pseudomonas aeruginosa Pa5196 type IV pilins at multiple sites with d-Ara f by a novel GT-C family arabinosyltransferase, TfpW. Journal of bacteriology, 190(22), pp.7464-7478.
Corresponding Author Lori L. Burrows
ContactFaculty of Dentistry, University of Toronto, Toronto, Ontario, Canada.
ReferenceVoisin, S., Kus, J.V., Houliston, S., St-Michael, F., Watson, D., Cvitkovitch, D.G., Kelly, J., Brisson, J.R. and Burrows, L.L., 2007. Glycosylation of Pseudomonas aeruginosa strain Pa5196 type IV pilins with mycobacterium-like α-1, 5-linked d-Ara f oligosaccharides. Journal of bacteriology, 189(1), pp.151-159.
Corresponding Author Lori L. Burrows
ContactInstitute for Biological Sciences, National Research Council, Ottawa, Canada.
ReferenceKus, J.V., Tullis, E., Cvitkovitch, D.G. and Burrows, L.L., 2004. Significant differences in type IV pilin allele distribution among Pseudomonas aeruginosa isolates from cystic fibrosis (CF) versus non-CF patients. Microbiology, 150(5), pp.1315-1326.
Corresponding Author Lori L. Burrows
Contact1.Department of Microbiology, Faculty of Dentistry, University of Toronto, Toronto, ON, Canada. 2.Centre for Infection and Biomaterials Research, Hospital for Sick Children Research Institute and Department of Surgery, University of Toronto, 7142A Elm Wing, 555 University Avenue, Toronto, ON, Canada M5G 1X8.
ReferenceKus, J.V., Kelly, J., Tessier, L., Harvey, H., Cvitkovitch, D.G. and Burrows, L.L. (2008) Modification of Pseudomonas aeruginosa Pa5196 type IV Pilins at multiple sites with D-Araf by a novel GT-C family Arabinosyltransferase, TfpW. J Bacteriol, 190, 7464-7478. [PubMed: 18805982]
AuthorKus, J.V., Kelly, J., Tessier, L., Harvey, H., Cvitkovitch, D.G. and Burrows, L.L
Research GroupDepartment of Biological Sciences, Duquesne University, 600 Forbes Ave., Pittsburgh, PA 15282, USA.
Corresponding Author Burrows, L.L.
ContactDepartment of Biological Sciences, Duquesne University, 600 Forbes Ave., Pittsburgh, PA 15282, USA.
Reference Voisin, S., Kus, J.V., Houliston, S., St-Michael, F., Watson, D., Cvitkovitch, D.G., Kelly, J., Brisson, J.R. and Burrows, L.L. (2007) Glycosylation of Pseudomonas aeruginosa strain Pa5196 type IV pilins with mycobacterium-like alpha-1,5-linked d-Araf oligosaccharides. J Bacteriol, 189, 151-159. [PubMed: 17085575]
Author Voisin, S., Kus, J.V., Houliston, S., St-Michael, F., Watson, D., Cvitkovitch, D.G., Kelly, J., Brisson, J.R. Burrows, L.L.
Research GroupInstitute for Biological Sciences, National Research Council, Ottawa, Canada.
Corresponding Author Burrows, L.L.
ContactInstitute for Biological Sciences, National Research Council, Ottawa, Canada.
Reference Kus, J.V., Tullis, E., Cvitkovitch, D.G. and Burrows, L.L. (2004) Significant differences in type IV pilin allele distribution among Pseudomonas aeruginosa isolates from cystic fibrosis (CF) versus non-CF patients. Microbiology, 150, 1315-1326. [PubMed: 15133094]
Author Kus, J.V., Tullis, E., Cvitkovitch, D.G. Burrows, L.L.
Research Group1 Centre for Infection and Biomaterials Research, Hospital for Sick Children Research Institute and Department of Surgery, University of Toronto, 7142A Elm Wing, 555 University Avenue, Toronto, ON, Canada M5G 1X8 2 Adult Cystic Fibrosis Clinic, St Michaels Hospital, Toronto, ON, Canada 3 Department of Microbiology, Faculty of Dentistry, University of Toronto, Toronto, ON, Canada
Corresponding Author Burrows LL
Contact1 Centre for Infection and Biomaterials Research, Hospital for Sick Children Research Institute and Department of Surgery, University of Toronto, 7142A Elm Wing, 555 University Avenue, Toronto, ON, Canada M5G 1X8 2. Department of Surgery, University of Toronto, 7142A Elm Wing, 555 University Avenue, Toronto, ON, Canada M5G 1X8.