ProGP257 (Microcystin-related protein C (MrpC))
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP257 (Microcystin-related protein C (MrpC)) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Microcystis aeruginosa PCC 7806 |
Domain | Bacteria |
Classification | Family: Microcystaceae Order: Chroococcales Class: Oscillatoriophycideae Division or phylum: "Cyanobacteria" |
Taxonomic ID (NCBI) | 1903187 |
Genome Information | |
GenBank | CP020771.1 |
EMBL | CP020771 |
Organism Additional Information | A toxic, unicellular and colonial cyanobacterium. |
Gene Information | |
Gene Name | mrpC (BH695_0840) |
Protein Information | |
Protein Name | Microcystin-related protein C (MrpC) |
UniProtKB/SwissProt ID | A0A1X9LBG1 |
NCBI RefSeq | WP_002740481.1 |
EMBL-CDS | ARI80121.1 |
UniProtKB Sequence | >tr|A0A1X9LBG1|A0A1X9LBG1_MICAE Uncharacterized protein OS=Microcystis aeruginosa PCC 7806SL OX=1903187 GN=BH695_0840 PE=4 SV=1 MKASNYQEIARGAILAGGLAAAGVLSVGEGAQAQFIGTASQSRVSAATTSILTDGNTAAT NSFAVEQVLPAADYVFSSPISVQISYDTLTLAKDKNFVAITGAVLTATVEVNSGTQLTVE RATADAISQAAAASQFGDVSGIVRAWTAGTSVLD |
Sequence length | 154 AA |
Subcellular Location | Surface |
Function | Role in cellular interactions. Microcystins, the most common cyanobacterial toxins (potent hepatotoxins), are implicated in colony specificity of and colony formation by Microcystis. |
Glycosylation Status | |
Glycosylation Type | O-linked |
Technique(s) used for Glycosylation Detection | Digoxigenin-glycan detection kit |
Glycan Information | |
Glycan Annotation | O-GlcNAc modifications though the exact glycan structure is unknown |
Technique(s) used for Glycan Identification | Western blotting using antibody against O-linked GlcNAc residues |
Literature | |
Year of Identification | 2008 |
Year of Identification Month Wise | 2008.04 |
Reference | Zilliges, Y., Kehr, J.C., Mikkat, S., Bouchier, C., de Marsac, N.T., Börner, T. and Dittmann, E., 2008. An extracellular glycoprotein is implicated in cell-cell contacts in the toxic cyanobacterium Microcystis aeruginosa PCC 7806. Journal of bacteriology, 190(8), pp.2871-2879. |
Corresponding Author | Elke Dittmann |
Contact | Humboldt University of Berlin, Institute for Biology, Molecular Ocology and Genetics, Chausseestr. 117, 10115 Berlin, Germany. |
Reference | Zilliges Y, Kehr JC, Mikkat S, Bouchier C, de Marsac NT, Börner T, Dittmann E. (2008) An extracellular glycoprotein is implicated in cell-cell contacts in the toxic cyanobacterium Microcystis aeruginosa PCC 7806. J Bacteriol., 190(8), 2871-9. [PubMed: 18281396] |
Author | Zilliges Y, Kehr JC, Mikkat S, Bouchier C, de Marsac NT, Börner T, Dittmann E. |
Research Group | Humboldt University Berlin, Institute of Biology, Molecular Ecology and Genetics, Chausseestr. 117, 10115 Berlin, Germany. |
Corresponding Author | Dittmann E. |
Contact | Humboldt University Berlin, Institute of Biology, Molecular Ecology and Genetics, Chausseestr. 117, 10115 Berlin, Germany. |