ProGP260 (FlaB2)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP260 (FlaB2)
Validation Status Characterized
Organism Information
Organism NameMethanococcus maripaludis S2
Domain Archaea
Classification Family: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 39152
Genome Information
GenBank BX950229.1
EMBL AF333233
Gene Information
Gene NameflaB2
NCBI Gene ID 2762290
GenBank Gene Sequence NC_005791
Protein Information
Protein NameFlaB2
UniProtKB/SwissProt ID Q9C4R2
NCBI RefSeq NP_988787.1
EMBL-CDSAAG50058.1
UniProtKB Sequence >tr|Q9C4R2|Q9C4R2_METMP FlaB2 OS=Methanococcus maripaludis GN=flaB2 PE=4 SV=1 MKITEFMKNKKGASGIGTLIVFIAMVLVAAVAASVLINTSGYLQQKASTTGKDSTEQVAS GLQIMGISGYQDGSAGANITKLAIYITPNAGSAAIDMNQVVLTLSDGSTKTVTKYDTTAY TNLTAGGDLYNTTTVNWSKLADTTEFGIVEIQDADLSFTSSAPVINKGDIVAIIVSGVSF DTRMKFQGSVQPEFGAPGVISFTTPSTFTEKVVSLQ
Sequence length 216 AA
Subcellular LocationSurface
Function Flagellin
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-12) N78, N122, N131, N136
Experimentally Validated Glycosite(s ) in Mature ProteinN66, N110, N119, N124
Glycosite(s) Annotated Protein Sequence >tr|Q9C4R2|Q9C4R2_METMP FlaB2 OS=Methanococcus maripaludis GN=flaB2 PE=4 SV=1 MKITEFMKNKKGASGIGTLIVFIAMVLVAAVAASVLINTSGYLQQKASTTGKDSTEQVAS GLQIMGISGYQDGSAGAN*(78)ITKLAIYITPNAGSAAIDMNQVVLTLSDGSTKTVTKYDTTAY TN*(122)LTAGGDLYN*(131)TTTVN*(136)WSKLADTTEFGIVEIQDADLSFTSSAPVINKGDIVAIIVSGVSF DTRMKFQGSVQPEFGAPGVISFTTPSTFTEKVVSLQ
Sequence Around Glycosites (21 AA) SGYQDGSAGANITKLAIYITP
VTKYDTTAYTNLTAGGDLYNT
TNLTAGGDLYNTTTVNWSKLA
GGDLYNTTTVNWSKLADTTEF
ProGP Web Logo
Technique(s) used for Glycosylation DetectionAberrant SDS-PAGE migration and glycan detection by MS
Technique(s) used for Glycosylated Residue(s) Detection NanoLC-MS/MS (nano-liquid chromatography-electrospray tandem mass spectrometry)
Protein Glycosylation- Implication Glycan is necessary for proper flagellar filament assembly and function. A minimal portion of the glycan (at least two sugars) is required to facilitate flagellar assembly and the presence of each additional sugar results in increased motility, as measured on semi-swarm plates.
Glycan Information
Glycan Annotation Linkage: β-GalNAc-Asn.
N-linked tetrasaccharide (1036.4 Da) composed of N-acetylgalactosamine, di-acetylated glucuronic acid, an acetylated and acetamidino-modified mannuronic acid linked to threonine, and a novel terminal sugar: Sug-4-β-ManNAc3NAmA6Thr-4-β-GlcNAc3NAcA-3-β-GalNAc-Asn where Sug is a novel monosaccharide unit, (5S)-2-acetamido-2,4-dideoxy-5-O-methyl-α-L-erythro-hexos-5-ulo-1,5-pyranose.
BCSDB ID 23737
GlyTouCan G54356DB
Technique(s) used for Glycan Identification NanoLC–MS/MS analysis and 1H, 13C NMR spectroscopy
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameAglB/STT3 subunit
OST ProGT IDProGT13 (AglB)
Literature
ReferenceJarrell, K.F., Jones, G.M. and Nair, D.B., 2010. Biosynthesis and role of N-linked glycosylation in cell surface structures of archaea with a focus on flagella and S layers. International journal of microbiology, 2010.
Corresponding Author Ken F. Jarrell
ContactDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.
ReferenceKelly, J., Logan, S.M., Jarrell, K.F., VanDyke, D.J. and Vinogradov, E., 2009. A novel N-linked flagellar glycan from Methanococcus maripaludis. Carbohydrate research, 344(5), pp.648-653.
ReferenceVanDyke, D.J., Wu, J., Logan, S.M., Kelly, J.F., Mizuno, S., Aizawa, S.I. and Jarrell, K.F., 2009. Identification of genes involved in the assembly and attachment of a novel flagellin N‐linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Molecular microbiology, 72(3), pp.633-644.
Corresponding Author Ken F. Jarrell
ContactDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.
ReferenceVanDyke, D.J., Wu, J., Ng, S.Y., Kanbe, M., Chaban, B., Aizawa, S.I. and Jarrell, K.F., 2008. Identification of a putative acetyltransferase gene, MMP0350, which affects proper assembly of both flagella and pili in the archaeon Methanococcus maripaludis. Journal of bacteriology, 190(15), pp.5300-5307.
Corresponding Author Ken F. Jarrell
ContactDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.
ReferenceJarrell, K.F., Jones, G.M. and Nair, D.B. (2010) Biosynthesis and role of N-linked glycosylation in cell surface structures of archaea with a focus on flagella and s layers. Int J Microbiol, 2010, 470138. [PubMed: 20976295]
AuthorJarrell, K.F., Jones, G.M. and Nair, D.B.
Research GroupDepartment of Microbiology and Immunology, Queens University, Kingston, ON, Canada
Corresponding Author Nair, D.B.
ContactDepartment of Microbiology and Immunology, Queens University, Kingston, ON, Canada
Reference Kelly, J., Logan, S.M., Jarrell, K.F., VanDyke, D.J. and Vinogradov, E. (2009) A novel N-linked flagellar glycan from Methanococcus maripaludis. Carbohydr Res, 344, 648-653. [PubMed: 19203750]
Author Kelly, J., Logan, S.M., Jarrell, K.F., VanDyke, D.J. and Vinogradov, E.
Research GroupInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada K1A 0R6.
Corresponding Author Vinogradov, E.
ContactInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada K1A 0R6.
ReferenceKelly, J., Logan, S.M., Jarrell, K.F., VanDyke, D.J. and Vinogradov, E. (2009) A novel N-linked flagellar glycan from Methanococcus maripaludis. Carbohydr Res, 344, 648-653. [PubMed: 19203750]
Author Kelly, J., Logan, S.M., Jarrell, K.F., V yke, D.J.
Research GroupInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada K1A 0R6.
Corresponding Author yke, D.J.
ContactInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada K1A 0R6.
ReferenceVanDyke, D.J., Wu, J., Logan, S.M., Kelly, J.F., Mizuno, S., Aizawa, S. and Jarrell, K.F. (2009) Identification of genes involved in the assembly and attachment of a novel flagellin N-linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Mol Microbiol, 72, 633-644. [PubMed: 19400781]
Author VanDyke, D.J., Wu, J., Logan, S.M., Kelly, J.F., Mizuno, S., Aizawa, S. and Jarrell, K.F
Research GroupDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K.F
ContactDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Reference VanDyke, D.J., Wu, J., Ng, S.Y., Kanbe, M., Chaban, B., Aizawa, S. and Jarrell, K.F. (2008) Identification of a putative acetyltransferase gene, MMP0350, which affects proper assembly of both flagella and pili in the archaeon Methanococcus maripaludis. J Bacteriol, 190, 5300-5307. [PubMed: 18539748]
Author VanDyke, D.J., Wu, J., Ng, S.Y., Kanbe, M., Chaban, B., Aizawa, S. and Jarrell, K.F.
Research GroupDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K.F.
ContactDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.