ProGP282 (prG)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP282 (prG) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Mycobacterium tuberculosis |
Domain | Bacteria |
Classification | Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" |
Taxonomic ID (NCBI) | 1773 |
Genome Information | |
GenBank | BX842576.1 |
EMBL | BX842576 |
Organism Additional Information | It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens. |
Gene Information | |
Gene Name | lprG (Rv1411c) |
NCBI Gene ID | 886700 |
GenBank Gene Sequence | NC_000962.2 |
Protein Information | |
Protein Name | LprG |
UniProtKB/SwissProt ID | P0A5I8 |
NCBI RefSeq | NP_215927.1 |
EMBL-CDS | CAB02197.1 |
UniProtKB Sequence | >sp|P0A5I8|LPRG_MYCTU Lipoprotein lprG OS=Mycobacterium tuberculosis GN=lprG PE=1 SV=1 MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHM VLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQW SDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQI APPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS |
Sequence length | 236 AA |
Subcellular Location | Membrane |
Function | 27 kDa lipoprotein. It is a TLR-2 ligand that inhibits human macrophage class II MHC antigen processing. |
Protein Structure | |
PDB ID | 3MH8, 3MH9, 3MHA |
Glycosylation Status | |
Technique(s) used for Glycosylation Detection | Concanavalin A (ConA) binding |
Literature | |
Year of Identification | 2009 |
Year of Identification Month Wise | 2009.2 |
Reference | González-Zamorano, M., Mendoza-Hernández, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C., 2009. Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. Journal of proteome research, 8(2), pp.721-733. |
Corresponding Author | Clara Espitia |
Contact | Immunology Department, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico. |
Reference | González-Zamorano M, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009, 8(2), 721-33. [PubMed: 19196185] |
Author | Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C |
Research Group | Department of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico. |
Corresponding Author | Espitia, C |
Contact | Department of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico. |